DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr3

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:101/286 - (35%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLW--RKGSSVLTAGHLKITRD 89
            |.:|.|....|       ||...:|       .|:|.:|....:.|  ::...:||.|....|.|
  Fly   240 FGMPRNITGRT-------GHTEAII-------KCRVDSLHDKSVSWIRKRDLHILTVGTATYTSD 290

  Fly    90 QRFKIV-----GDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEIL-VPPTLRAL----PHNG 144
            :||::.     .::.|.:.....:|:|.|.||:..:........:.|: :.|..:|:    |   
  Fly   291 KRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPP--- 352

  Fly   145 QVTARKGSTVTLEC---KASGNPVPTIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSAD 206
            .:..:.||.:.|.|   :.|...:..|:|::.:....|....|....|......|..|..:.::.
  Fly   353 DLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSP 417

  Fly   207 NGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRR 271
            |.:...|  |:|:...:  .|.:|                               |.|.|....|
  Fly   418 NDIMSEV--DLQMEFAT--RIAME-------------------------------SQLGDTLKSR 447

  Fly   272 SMYPRDDRYSLIIRNFQPTDFGNYSC 297
                      |.|.|.|.||.|||:|
  Fly   448 ----------LRISNAQTTDTGNYTC 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 19/90 (21%)
Ig 56..116 CDD:143165 15/66 (23%)
IG_like 144..221 CDD:214653 16/79 (20%)
IGc2 151..209 CDD:197706 13/60 (22%)
IG_like 232..313 CDD:214653 14/66 (21%)
Ig 242..311 CDD:143165 14/56 (25%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 23/100 (23%)
IG_like 243..329 CDD:214653 23/99 (23%)
Ig 350..464 CDD:299845 33/162 (20%)
IG_like <441..477 CDD:214653 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.