DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr4

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:114/235 - (48%) Gaps:36/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTLVLYLFSFSLSLIGGSFILPEN--DPPTTAPKF--LSRGHLYKVIVGETIELPCKVQNLGSFV 69
            | |:|:|   ...::||.  :|.:  :.|.:.|.|  .||..: ...||:...|.|:|:|||...
  Fly    19 W-LLLFL---DCGMVGGE--VPPHYWETPYSQPYFDNSSRREV-TATVGQAALLHCRVRNLGDRA 76

  Fly    70 LLW--RKGSSVLTAGHLKITRDQRFKIV-----GDYNLQINGVKTQDAGDYICQLGDQENRDQVH 127
            :.|  ::...:||.|.|..|.||||:.:     .::.|:|:..:.:|:|.|.||:..:....|..
  Fly    77 VSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGF 141

  Fly   128 TVEILVPPTLRA-LPHNGQVTARKGSTVTLECKASGNPVPT--IFWFK-KDVFS-----GPTHLS 183
            .:.::|.   || :..|.::..:.||.:.|.|.|..:|||.  |:|:| |.|.:     |...::
  Fly   142 RLNVVVS---RAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVIT 203

  Fly   184 DSST----LILENVDRHHAGTYQCSADNGVKDRVSMDIQL 219
            :.||    |::.......:|.|.||..:  .|..|:.:.:
  Fly   204 ERSTRTSKLLIAKATPADSGNYTCSPSS--SDSASVVVHV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/89 (29%)
Ig 56..116 CDD:143165 21/66 (32%)
IG_like 144..221 CDD:214653 23/88 (26%)
IGc2 151..209 CDD:197706 21/69 (30%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr4NP_001014616.2 V-set 53..146 CDD:284989 26/93 (28%)
IG_like 53..145 CDD:214653 26/92 (28%)
ig 153..227 CDD:278476 20/73 (27%)
IG_like 161..>227 CDD:214653 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.