DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr18

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:347 Identity:80/347 - (23%)
Similarity:133/347 - (38%) Gaps:111/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TTYTRKYWTLVLYLFSFSLSLI--------------GGSFILPENDPPTTAPKFLSRGHLYKVIV 52
            :|.||.:||      :...:.:              |..|..|.|. .|:....:|..||:...|
  Fly   186 STRTRNHWT------ASGFARVTERPRSKHHHEHHWGPFFEEPINS-ATSGDNLVSAVHLFTEAV 243

  Fly    53 GETIELPCKVQNLGSFVLLWRKGS----SVLTAGHLKITRDQR----FKIVGDYNLQINGVKTQD 109
                 |.|:|..|....::|.:.:    |:||.|::..:.|.|    |:...::.|.||..:|:|
  Fly   244 -----LNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTED 303

  Fly   110 AGDYICQLGDQENRDQVHTVEILVPPTLRALPHN----GQVTARKGSTVTLECKASGNPVPTIFW 170
            ||.|:||:.....|.....:.:|.|| ||.:..:    |....:.||||.|:|:.|.:      :
  Fly   304 AGVYMCQVSTHPPRVFTTNLTVLEPP-LRIIDEHERDVGDRYYKSGSTVDLQCQISRS------F 361

  Fly   171 FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWV- 234
            |:|:           ...||::.|         ||::.|:..::           |.|.|.:.: 
  Fly   362 FQKE-----------RQTILKSTD---------SANDAVQKLIN-----------ETTSELNLIG 395

  Fly   235 ------HASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDR----------YSLI 283
                  |...|.|:|.              |...|:..|.|...:....:|          ..:.
  Fly   396 NVNQTQHKFSGQDLEK--------------YFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRIS 446

  Fly   284 IRNFQPTDFGNYSCVADNALGR 305
            |.:.:.:|.|||||    :|||
  Fly   447 IGDAKLSDSGNYSC----SLGR 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/90 (27%)
Ig 56..116 CDD:143165 20/67 (30%)
IG_like 144..221 CDD:214653 16/76 (21%)
IGc2 151..209 CDD:197706 14/57 (25%)
IG_like 232..313 CDD:214653 19/91 (21%)
Ig 242..311 CDD:143165 16/74 (22%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/87 (28%)
Ig <258..326 CDD:299845 19/67 (28%)
IGc2 <417..461 CDD:197706 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.