DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Negr1

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:344 Identity:95/344 - (27%)
Similarity:140/344 - (40%) Gaps:79/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKI----VGDYNLQINGVKTQDAGDY 113
            |:|..|.|.::: |:....|...||::.||..|.:.|.|..|    ..||:|||..|...|.|.|
Mouse    47 GDTAVLRCYLED-GASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPY 110

  Fly   114 ICQLGDQE--NRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVF 176
            .|.:..|.  ...||| :.:.|||.:..:  :..:|..:|:.|||.|.|:|.|.|.|.|      
Mouse   111 TCSVQTQHTPRTMQVH-LTV
QVPPKIYDI--SNDMTINEGTNVTLTCLATGKPEPVISW------ 166

  Fly   177 SGPTHLSDSST-------LILENVDRHHAGTYQCSADNGV------KDRVSMDIQLTI--LSPPE 226
               .|:|.|:.       |.:..:.|..||.|:|||:|.|      |.||.::...||  :....
Mouse   167 ---RHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVIVNFAPTIQEIKSGT 228

  Fly   227 ITVEKSWVHASEGYDVELVCIVHGDVNSEMLWY---------QNSFLLDATDRRSMYPRDDRYSL 282
            :|..:|.:...||..|.         .....||         |...::.....||:        |
Mouse   229 VTPGRSGLIRCEGAGVP---------PPAFEWYKGEKRLFNGQQGIIIQNFSTRSI--------L 276

  Fly   283 IIRNFQPTDFGNYSCVADNALGRT------KKYIE-------VSGRPGPADF-ISPALSGFLDHY 333
            .:.|.....||||:|||.|.||.|      .:.||       .|..|..|.: |:.:.......:
Mouse   277 TVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSSPVTSPAPSTAQYGITGSACDLFSCW 341

  Fly   334 NLTWTIESIPPLDEIKLLY 352
            :|..|:.|:     |.:.|
Mouse   342 SLALTLSSV-----ISIFY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 28/85 (33%)
Ig 56..116 CDD:143165 21/63 (33%)
IG_like 144..221 CDD:214653 28/89 (31%)
IGc2 151..209 CDD:197706 23/64 (36%)
IG_like 232..313 CDD:214653 24/102 (24%)
Ig 242..311 CDD:143165 19/83 (23%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 3/7 (43%)
Ig strand A' 40..46 CDD:409353
IG_like 41..129 CDD:214653 28/83 (34%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 1/6 (17%)
Ig strand C 61..67 CDD:409353 1/5 (20%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 13/34 (38%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 4/5 (80%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 3/7 (43%)
Ig strand A' 139..144 CDD:409353 0/4 (0%)
IGc2 146..204 CDD:197706 23/66 (35%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 2/13 (15%)
Ig strand C' 170..172 CDD:409353 1/1 (100%)
Ig strand E 180..186 CDD:409353 1/5 (20%)
Ig strand F 193..200 CDD:409353 4/6 (67%)
Ig_3 219..295 CDD:404760 21/92 (23%)
putative Ig strand A 219..225 CDD:409353 2/5 (40%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/11 (18%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.