DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr14

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:261 Identity:58/261 - (22%)
Similarity:92/261 - (35%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYTRKYWTLVLYLFSFSLSLIGGSFILPENDPP----------TTAPKFLSRGHLYKVI-----V 52
            |:.:.:|.               .|..|..|.|          ||...|......|..:     :
  Fly    39 TFPKNFWQ---------------EFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQL 88

  Fly    53 GETIELPCKVQNLGSFVLLW--RKGS--SVLTAGHLKITRDQRFKI----VGDYNLQINGVKTQD 109
            ..::.|.|:|.:|....:.|  |:|.  :::|.|....:.|.|:.:    ..|:.|.|.....:|
  Fly    89 SSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERD 153

  Fly   110 AGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARK----GSTVTLECKASGNPVPT--I 168
            .|.|.||:........:..:.|:| |.:..|...|..|..|    |||:.|:|..|..|.|:  |
  Fly   154 EGPYECQVSSHPPLVLLVYLTIIV-PHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYI 217

  Fly   169 FW-----------------FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMD 216
            .|                 .|.|:..|..    .|.|.:.|.:|...|.|.|...|.:.:.|.:.
  Fly   218 TWRHGPRLLNYDTSRGGISVKTDMLPGRA----LSRLYIANANRQDTGNYTCMLGNEITETVVVH 278

  Fly   217 I 217
            :
  Fly   279 V 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 20/95 (21%)
Ig 56..116 CDD:143165 17/67 (25%)
IG_like 144..221 CDD:214653 25/97 (26%)
IGc2 151..209 CDD:197706 21/76 (28%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/79 (24%)
Ig 84..169 CDD:299845 19/84 (23%)
IG_like 191..279 CDD:214653 23/91 (25%)
Ig 201..274 CDD:143165 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.