DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Dscaml1

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:401 Identity:98/401 - (24%)
Similarity:164/401 - (40%) Gaps:74/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRF- 92
            |...||..:.|..|...|..:|..|..:||||.........:.|.|....|.|       |.|: 
  Rat   274 LSVTDPAESIPTILDGFHSQEVWTGHAVELPCAASGYPIPAIRWLKDGRPLPA-------DSRWA 331

  Fly    93 -KIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARK-----G 151
             :|.|   |.|:.::|:|:|.|||::.:.....:.:.|..::.|.      :..:|.:|     |
  Rat   332 KRITG---LTISDLRTEDSGTYICEVTNTFGSAEANGVLTVIDPL------HVTLTPKKLKTGIG 387

  Fly   152 STVTLECKASGNPVPTIFWFKKDVFSGPTH------LSDSSTLILENVDRHHAGTYQCSADNGVK 210
            |||.|.|..:|:|..||.|::......|..      || :.||::.:..:.|:|.|||.|..  |
  Rat   388 STVILSCALTGSPEFTIRWYRNTELVLPGEAISIRGLS-NETLLISSAQKSHSGAYQCFATR--K 449

  Fly   211 DRVSMDIQLTIL--SPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWY--QNSFLLDATDRR 271
            .:.:.|..:.:|  ..|.|....|....:.|....|:|...|.....:.|.  ....:.|.:.|.
  Rat   450 AQTAQDFAIIVLEDGTPRIVSSFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPVVRDGSHRT 514

  Fly   272 SMYPRDDRYSLIIRNF---QPTDFGNYSCVADNALGRTKKY---IEVSGRP------------GP 318
            :.|...|..::...|.   |..|.|.|.|.|.|::| :.:|   |.|.|.|            |.
  Rat   515 NQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNSVG-SAEYQARINVRGPPSIRAMRNITAVAGR 578

  Fly   319 ADFISPALSGFLDHYNLTWTIESIPPLDEIKLLYRRLLM-NETYQHPGKWHEYHIKPTPIR--TD 380
            ...|:..:.|: .:|::.|..:::...|.    :|:::. |.|           :|.|.::  .|
  Rat   579 DTLINCRVIGY-PYYSIKWYKDALLLPDN----HRQVVFENGT-----------LKLTDVQKGMD 627

  Fly   381 GSHFLMSYLVK 391
            ...:|.|.|::
  Rat   628 EGEYLCSVLIQ 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/84 (27%)
Ig 56..116 CDD:143165 19/61 (31%)
IG_like 144..221 CDD:214653 26/87 (30%)
IGc2 151..209 CDD:197706 22/63 (35%)
IG_like 232..313 CDD:214653 21/88 (24%)
Ig 242..311 CDD:143165 18/76 (24%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845 1/1 (100%)
IG_like 195..276 CDD:214653 1/1 (100%)
I-set 291..369 CDD:254352 24/87 (28%)
IGc2 298..359 CDD:197706 21/70 (30%)
IGc2 386..447 CDD:197706 21/61 (34%)
I-set 466..560 CDD:254352 23/94 (24%)
Ig 466..556 CDD:299845 22/90 (24%)
IGc2 577..635 CDD:197706 13/73 (18%)
IG_like 665..744 CDD:214653
Ig 673..739 CDD:143165
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.