DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Fas2

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:580 Identity:113/580 - (19%)
Similarity:190/580 - (32%) Gaps:183/580 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNL-QI 102
            |:.:|.....:.:.|:.....|..:......:.|     :..|..|.:....||::.....| .|
  Fly   230 PEIISLPTNLEAVEGKPFAANCTARGKPVPEISW-----IRDATQLNVATADRFQVNPQTGLVTI 289

  Fly   103 NGVKTQDAGDYICQLGDQENR----DQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGN 163
            :.|...|.|.|.|.   .:||    ||...:.:||.|.:..| :|  ||..:...:.:.|:|.|.
  Fly   290 SSVSQDDYGTYTCL---AKNRAGVVDQKTKLNVLVRPQIYEL-YN--VTGARTKEIAITCRAKGR 348

  Fly   164 PVPTIF---WFKKDVFSGPTHLSD----------------SSTLILENVDRHHAGTYQCSADNGV 209
            |.|.|.   |..::.::......|                :.||.:.|.:|...|.|||.|.|..
  Fly   349 PAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKG 413

  Fly   210 KDRVSMDIQLTILSPPEITVEK------SWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDAT 268
            .|..... .:|:...|:.:..|      ||    |.....|.|:..|..|:.:.|:.|...:   
  Fly   414 ADAYKTG-HITVEFAPDFSHMKELPPVFSW----EQRKANLSCLAMGIPNATIEWHWNGRKI--- 470

  Fly   269 DRRSMY----------PRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYIEVSGRPGPADFIS 323
              :.:|          ||.|   ||:.......:..|.|:|.|..|..:..:::.....| ||:|
  Fly   471 --KDLYDTNLKIVGTGPRSD---LIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVP-DFVS 529

  Fly   324 -------------------------PALSGFLDH-----------YNLTWT------IESIPPLD 346
                                     |.|:..:.:           ||.:|:      :|.:.|..
  Fly   530 EAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQT 594

  Fly   347 EIKLLY--------------------RRLL------MNETYQHPG---------------KW--- 367
            |....:                    ||..      ::...||..               :|   
  Fly   595 EYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVP 659

  Fly   368 -------HEYHIKPTP-IRTDG-----------------SHFLMSYLVKNLEHNAVYEAIVQAKN 407
                   ..|.||..| ::..|                 :.|.|:.||    .|..|...::|.|
  Fly   660 ADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLV----GNTYYRIELKAHN 720

  Fly   408 KYGWNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVSGIILSAFILVLYPIISV 467
            ..|::..:.|....||..|:   |.:..:...||...:...:.|::|..|::.|...|:|
  Fly   721 AIGYSSPASIIMKTTRGIDV---IQVAERQVFSSAAIVGIAIGGVLLLLFVVDLLCCITV 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 18/87 (21%)
Ig 56..116 CDD:143165 12/60 (20%)
IG_like 144..221 CDD:214653 21/95 (22%)
IGc2 151..209 CDD:197706 18/76 (24%)
IG_like 232..313 CDD:214653 20/90 (22%)
Ig 242..311 CDD:143165 17/78 (22%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 20/96 (21%)
IGc2 243..309 CDD:197706 16/73 (22%)
IG_like 330..424 CDD:214653 22/96 (23%)
IGc2 339..412 CDD:197706 17/72 (24%)
Ig 447..518 CDD:143165 17/78 (22%)
fn3 534..611 CDD:278470 8/76 (11%)
FN3 640..735 CDD:238020 16/98 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.