DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Iglon5

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:309 Identity:82/309 - (26%)
Similarity:138/309 - (44%) Gaps:22/309 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIV----GDYNL 100
            :|.|....|.|..|:...|.|.:....:.| .|...|::|.||:.:.|.|.|.:::    .::::
  Rat    34 EFSSPADNYTVCEGDNATLSCFIDEHVTRV-AWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSI 97

  Fly   101 QINGVKTQDAGDYICQLGDQENRDQVHTVEI--LVPPTLRALPHNGQVTARKGSTVTLECKASGN 163
            .|..|...|.|.|.|..   :.|.|.:|.::  :|....|.:..:..|...:|..|.|.|.|.|.
  Rat    98 LITQVGLGDEGLYTCSF---QTRHQPYTTQVYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGR 159

  Fly   164 PVPTIFWFK-KDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRV-SMDIQLTILSPPE 226
            |.||:.|.: :|.|:     |:...|.:.::.|..||.|:|...|||.... |..:.:|:..||.
  Rat   160 PEPTVTWRQLRDGFT-----SEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPT 219

  Fly   227 ITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDD--RYSLIIRNFQP 289
            || :.:....:.|....|.|.......::..||::..||.:.....:..:.:  |..|:..|...
  Rat   220 IT-DVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSA 283

  Fly   290 TDFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYN-LTW 337
            ..:|||:|.|.|.||.:...:.:. |||..:..:|...|.|...: |:|
  Rat   284 RHYGNYTCRAANRLGASSASMRLL-RPGSLENSAPRPPGPLTLLSALSW 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 22/88 (25%)
Ig 56..116 CDD:143165 16/63 (25%)
IG_like 144..221 CDD:214653 24/78 (31%)
IGc2 151..209 CDD:197706 20/58 (34%)
IG_like 232..313 CDD:214653 18/82 (22%)
Ig 242..311 CDD:143165 17/70 (24%)
Iglon5XP_218634.5 Ig 41..129 CDD:416386 23/91 (25%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 2/7 (29%)
Ig strand C 61..67 CDD:409353 2/6 (33%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/37 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/10 (30%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 21/69 (30%)
Ig strand A' 140..145 CDD:409353 1/4 (25%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 1/7 (14%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 19/78 (24%)
putative Ig strand A 218..224 CDD:409353 3/6 (50%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.