DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Lsamp

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:329 Identity:94/329 - (28%)
Similarity:143/329 - (43%) Gaps:42/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKYWTLVLYLFSFSLSLIGGSFILPENDPPT-------TAPKF------LSRG-HLYKVIVGETI 56
            |.||...:::..|.|||.....:...|.||.       |.|..      .:|| ....|..|:|.
  Rat     2 RTYWLHSVWVLGFFLSLFSLQVLAFWNQPPAEVNLSPITIPGLPVRSVDFNRGTDNITVRQGDTA 66

  Fly    57 ELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKI----VGDYNLQINGVKTQDAGDYICQL 117
            .|.|.|::..|.| .|...|.::.|||.|.:.|.|.::    ..:|:|:|..|...|.|.|.|.:
  Rat    67 ILRCVVEDKNSKV-AWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSV 130

  Fly   118 GDQE--NRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPT 180
            ..|.  ...||:.: :.|||.:..:  :..||..:||.|||.|.|:|.|.|.|.|         .
  Rat   131 QTQHEPKTSQVYLI-VQVPPKISNI--SSDVTVNEGSNVTLVCMANGRPEPVITW---------R 183

  Fly   181 HLS--------DSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHAS 237
            ||:        :...|.:..:.|..:|.|:|.|.|.|.......:::|:..||.||..|| ..|:
  Rat   184 HLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKS-NEAT 247

  Fly   238 EGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNA 302
            .|....|.|........:..||::...:::.:...:...:.:.||.:.|.....:|||:|||.|.
  Rat   248 TGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANK 312

  Fly   303 LGRT 306
            ||.|
  Rat   313 LGVT 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 27/88 (31%)
Ig 56..116 CDD:143165 20/63 (32%)
IG_like 144..221 CDD:214653 24/84 (29%)
IGc2 151..209 CDD:197706 21/65 (32%)
IG_like 232..313 CDD:214653 20/75 (27%)
Ig 242..311 CDD:143165 17/65 (26%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 27/91 (30%)
FR1 55..71 CDD:409353 4/15 (27%)
Ig strand A' 56..62 CDD:409353 1/5 (20%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 1/3 (33%)
FR2 77..84 CDD:409353 3/7 (43%)
Ig strand C 77..83 CDD:409353 3/6 (50%)
CDR2 85..95 CDD:409353 4/9 (44%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 1/2 (50%)
FR3 96..131 CDD:409353 10/34 (29%)
Ig strand D 100..107 CDD:409353 1/6 (17%)
Ig strand E 110..116 CDD:409353 2/5 (40%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 2/9 (22%)
FR4 138..145 CDD:409353 2/7 (29%)
Ig_3 148..218 CDD:404760 24/80 (30%)
Ig strand A' 155..160 CDD:409353 1/4 (25%)
Ig strand B 166..173 CDD:409353 4/6 (67%)
Ig strand C 179..184 CDD:409353 2/13 (15%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 1/5 (20%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 0/7 (0%)
Ig_3 235..311 CDD:404760 21/76 (28%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 2/3 (67%)
Ig strand F 304..309 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.