Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_981954.2 | Gene: | Ncam2 / 288280 | RGDID: | 1303131 | Length: | 837 | Species: | Rattus norvegicus |
Alignment Length: | 477 | Identity: | 109/477 - (22%) |
---|---|---|---|
Similarity: | 175/477 - (36%) | Gaps: | 124/477 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 GETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQL 117
Fly 118 GDQENRDQVHTVEIL----VPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFK------ 172
Fly 173 ---KDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGV-KDRVSMDIQLTILSPPEITVEKSW 233
Fly 234 VHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDAT----------DRRSMYPRDDRYSLIIRNFQ 288
Fly 289 PTDFGNYSCVADNALGRTKK------------------YIEVSGRP----------GPADF---- 321
Fly 322 -------------------------ISPALSGFLDHYNLTWT----------------IESIP-- 343
Fly 344 -PLDEIKLLYRRLLMNETYQHPG-KWHEYHIKPTPIRTD-----GSHFLMSYLV-KNLEHNAVYE 400
Fly 401 AIVQAKNKYGWNEISDIHQFYT 422 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 22/83 (27%) |
Ig | 56..116 | CDD:143165 | 15/59 (25%) | ||
IG_like | 144..221 | CDD:214653 | 26/86 (30%) | ||
IGc2 | 151..209 | CDD:197706 | 22/66 (33%) | ||
IG_like | 232..313 | CDD:214653 | 21/108 (19%) | ||
Ig | 242..311 | CDD:143165 | 20/96 (21%) | ||
Ncam2 | NP_981954.2 | IgI_1_NCAM-2 | 21..113 | CDD:409452 | |
Ig strand B | 38..42 | CDD:409452 | |||
Ig strand C | 50..54 | CDD:409452 | |||
Ig strand E | 76..80 | CDD:409452 | |||
Ig strand F | 90..95 | CDD:409452 | |||
Ig strand G | 104..107 | CDD:409452 | |||
IGc2 | 128..189 | CDD:197706 | 18/65 (28%) | ||
Ig strand B | 130..139 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 145..153 | CDD:409353 | 1/7 (14%) | ||
Ig strand C' | 156..159 | CDD:409353 | 1/7 (14%) | ||
Ig strand D | 162..167 | CDD:409353 | 2/4 (50%) | ||
Ig strand E | 168..175 | CDD:409353 | 4/6 (67%) | ||
IgI_1_MuSK | 209..298 | CDD:409562 | 26/93 (28%) | ||
Ig strand B | 228..232 | CDD:409562 | 2/3 (67%) | ||
Ig strand C | 241..245 | CDD:409562 | 1/3 (33%) | ||
Ig strand E | 264..268 | CDD:409562 | 1/3 (33%) | ||
Ig strand F | 278..283 | CDD:409562 | 2/4 (50%) | ||
Ig strand G | 291..294 | CDD:409562 | 0/2 (0%) | ||
Ig | 300..397 | CDD:416386 | 23/102 (23%) | ||
Ig strand A | 300..305 | CDD:409353 | 1/6 (17%) | ||
Ig strand A' | 309..313 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 317..325 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 331..337 | CDD:409353 | 2/8 (25%) | ||
Ig strand C' | 340..343 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 353..359 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 362..368 | CDD:409353 | 3/5 (60%) | ||
Ig strand F | 376..384 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 387..397 | CDD:409353 | 1/9 (11%) | ||
Ig_3 | 401..479 | CDD:404760 | 10/77 (13%) | ||
Ig strand B | 418..422 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 431..435 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 458..462 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 472..477 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 486..489 | CDD:409353 | 0/2 (0%) | ||
FN3 | 496..588 | CDD:238020 | 23/91 (25%) | ||
fn3 | 594..678 | CDD:394996 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |