DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Dscam4

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:459 Identity:111/459 - (24%)
Similarity:193/459 - (42%) Gaps:108/459 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSFILPEN------DPPTTAPKFLSRGH--LYKVIVG---ETIELPCKVQNLGSF---VLLW--- 72
            |..||.:|      |||....|.:.:..  :|:..|.   |.|:...::| ||..   :|.|   
  Fly   367 GKPILRDNRVEILTDPPRLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQ-LGDASPELLYWFSE 430

  Fly    73 ---RKGSSV----LTAGH-----------LKITRDQRFKIVGDY---------NLQINGVKTQDA 110
               :.|.:|    :..|:           ..|....|| :||.|         ::.|:.||.:|.
  Fly   431 QTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRF-LVGQYVTIHDDVISHVNISNVKEEDG 494

  Fly   111 GDYIC----QLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWF 171
            |:|.|    .:|...:..:|:...:   |.:|.:|   ::|...||.:.::|..:|.|:..|.| 
  Fly   495 GEYTCTAQNAIGKVSHSAKVNIYGL---PYIREMP---KITGISGSDLIVKCPVAGYPIDKIHW- 552

  Fly   172 KKDVFSGPTH----LSDSSTLILENVDR-HHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEK 231
            ::|..:.|.:    ..::.|||:|.:.| ..||||.|.|.|..|.....::::.:|.||:|...:
  Fly   553 ERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQ 617

  Fly   232 SWVH-ASEGYDVELVC-IVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRY--SLIIRNFQPTDF 292
            :..: ..||....:.| |:.||:.....|.:|...|..|. ..::.|.|.|  ||:|.:......
  Fly   618 AMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTG-NEVFRRLDEYSASLVIEHISSDHS 681

  Fly   293 GNYSCVADNALGRTKKY---IEVSGRP----GPADFISPALSGFLDHY--------NLTWTIESI 342
            |||:|:|.|..| |:::   :.|:..|    .|.|..:.|.:..|.|.        .:||. ::|
  Fly   682 GNYTCIASNVAG-TERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWK-KAI 744

  Fly   343 PPLDEIKLLYRRLLMNETYQHPGKWHEYHIKPT-PIRTDGSHFLMSYLVKNLEHNAVYEAIVQAK 406
            .|.                  ||::.::..:|| .:..:|:.|.     |.:...:....:.:||
  Fly   745 GPT------------------PGEYKDFLYEPTVQLFPNGTIFF-----KKISKESQGHFLCEAK 786

  Fly   407 NKYG 410
            |..|
  Fly   787 NNIG 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/122 (21%)
Ig 56..116 CDD:143165 22/96 (23%)
IG_like 144..221 CDD:214653 23/81 (28%)
IGc2 151..209 CDD:197706 21/62 (34%)
IG_like 232..313 CDD:214653 24/87 (28%)
Ig 242..311 CDD:143165 22/74 (30%)
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 13/50 (26%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549 1/3 (33%)
Ig strand F 397..402 CDD:409549 1/4 (25%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 20/94 (21%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 26/90 (29%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 2/4 (50%)
Ig strand E 571..575 CDD:409550 2/3 (67%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 27/94 (29%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 1/8 (13%)
Ig strand C 641..648 CDD:409353 1/6 (17%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 3/6 (50%)
Ig strand F 682..690 CDD:409353 5/7 (71%)
Ig strand G 693..702 CDD:409353 2/9 (22%)
IgI_7_Dscam 706..801 CDD:409546 21/109 (19%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 1/3 (33%)
Ig strand E 766..770 CDD:409546 1/3 (33%)
Ig strand F 780..785 CDD:409546 0/4 (0%)
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386
putative Ig strand B 820..827 CDD:409353
putative Ig strand C 835..841 CDD:409353
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.