DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and SIGLEC9

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_006723209.1 Gene:SIGLEC9 / 27180 HGNCID:10878 Length:481 Species:Homo sapiens


Alignment Length:284 Identity:69/284 - (24%)
Similarity:93/284 - (32%) Gaps:91/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TRDQRFKIVGD-----YNLQINGVKTQDAGDYICQL-------GDQENRDQV------HTVEILV 133
            ||| ||.::||     ..|.|...:..|||.|..::       ..:.:|..|      |...||:
Human    87 TRD-RFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILI 150

  Fly   134 PPTLRALPHNGQVTARKGSTVTLECKA-----SGNPVPTIFWFKKDVFSGPTHLSDSSTLILENV 193
            |.||.:           |....|.|..     .|.| |.|.|....|.......:.||.|.|...
Human   151 PGTLES-----------GCPQNLTCSVPWACEQGTP-PMISWIGTSVSPLDPSTTRSSVLTLIPQ 203

  Fly   194 DRHHAGTYQCSAD-NGVKDRVSMDIQLTILSPPE---ITV------------EKSWVHASEGYDV 242
            .:.|..:..|... .|.....:..:.|.:..||:   :||            ..|.:...||..:
Human   204 PQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSL 268

  Fly   243 ELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNF-----QPT------------ 290
            .|||.|                 ||.|  |..|.  |.||..|..     ||:            
Human   269 RLVCAV-----------------DAVD--SNPPA--RLSLSWRGLTLCPSQPSNPGVLELPWVHL 312

  Fly   291 -DFGNYSCVADNALGRTKKYIEVS 313
             |...::|.|.|.||..:.|:.||
Human   313 RDAAEFTCRAQNPLGSQQVYLNVS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 17/63 (27%)
Ig 56..116 CDD:143165 13/33 (39%)
IG_like 144..221 CDD:214653 17/82 (21%)
IGc2 151..209 CDD:197706 15/63 (24%)
IG_like 232..313 CDD:214653 25/98 (26%)
Ig 242..311 CDD:143165 22/86 (26%)
SIGLEC9XP_006723209.1 Ig_Siglec_N 23..140 CDD:143189 15/53 (28%)
IG_like 26..>118 CDD:214653 12/31 (39%)
Ig 151..222 CDD:299845 19/82 (23%)
IG_like 258..336 CDD:214653 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.