DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and DIP-lambda

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:407 Identity:95/407 - (23%)
Similarity:167/407 - (41%) Gaps:62/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAG---HLKITRDQRFKIV----G 96
            |:||::.....|.:|..|...|.|.|||.:.:.|.|..|....|   |: ::.:.|..:.    .
  Fly    50 PQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHM-VSLNPRLSVTHNGHN 113

  Fly    97 DYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALP-HNGQ-VTARKGSTVTLECK 159
            .:.|.|:.|:..|:|.|:||:.....:.....::::|||.:...| ||.: ...::|.:::|.|.
  Fly   114 TWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCS 178

  Fly   160 ASGNPVPTIFWFK---KDVF---SGPTHLS----DSSTLILENVDRHHAGTYQCSADNGVKDRVS 214
            .:|.|.|.:.|.:   |::.   .|.....    :...|:|.||.|...|.|.|.|.||:...||
  Fly   179 VTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVS 243

  Fly   215 MDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEML--WYQNSFLLDATDRRSMYPRD 277
            ....:.:...|.:......|.|....:|.|.|||  :|..:.|  ||::...:...:.......:
  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVEREVTLECIV--EVFPKPLNGWYRSEGNIKLHNGNKYNISE 306

  Fly   278 D-------RYSLIIRNFQPTDFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNL 335
            :       ..:|.||:...:|||.|||.:.||||:::..|.:.....|                 
  Fly   307 EVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLP----------------- 354

  Fly   336 TWTIESIPPLDEIKLLYRRLLMNETYQHPGKWHEYHIKPTPIRTDGSHFLMSYLVKNLEHNAVYE 400
                   |.|......:.:.......:||.. |:..:... :|...:||......:|.:||..::
  Fly   355 -------PKLTTTPTPHMQTTGKSRRKHPAS-HKKGLNEV-LRFQETHFANQIQQENEDHNEGFD 410

  Fly   401 AIVQAKNKYGWNEISDI 417
            .:     |:..:|.|:|
  Fly   411 LL-----KFTNSENSNI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 22/89 (25%)
Ig 56..116 CDD:143165 18/66 (27%)
IG_like 144..221 CDD:214653 22/87 (25%)
IGc2 151..209 CDD:197706 19/67 (28%)
IG_like 232..313 CDD:214653 25/89 (28%)
Ig 242..311 CDD:143165 22/77 (29%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
21.910

Return to query results.
Submit another query.