DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Ncam1

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:636 Identity:132/636 - (20%)
Similarity:218/636 - (34%) Gaps:251/636 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGSFVLLWR-KGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQ 116
            ||...:.|.|.:.....::|: ||..|:      :.:|.||.::.:..|||.|:|..|.|.|.|:
  Rat   132 GEDAVIVCDVVSSLPPTIIWKHKGRDVI------LKKDVRFIVLSNNYLQIRGIKKTDEGTYRCE 190

  Fly   117 LGDQENRDQVH----TVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFK----- 172
             |....|.:::    .|.:.||||::|.......||..|.:|||.|.|.|.|.||:.|.|     
  Rat   191 -G
RILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPI 254

  Fly   173 --------KDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN--GVKDRVSMDIQLTILSPPEI 227
                    |.:||     .|||.|.:.|||::....|.|.|:|  |.:|   ..|.|.:.:.|:|
  Rat   255 ENEEEDDEKHIFS-----DDSSELTIRNVDKNDEAEYVCIAENKAGEQD---ASIHLKVFAKPKI 311

  Fly   228 TVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRY------------ 280
            |..::.........|.|.|...||....:.|..::..:.:.::.| :.|.::.            
  Rat   312 TYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKAS-WTRPEKQETLDGHMVVRSH 375

  Fly   281 ----SLIIRNFQPTDFGNYSCVADNALGRTKK--YIEVSGRP---GPA----------------- 319
                ||.:::.|.||.|.|.|.|.|.:|:..:  |:||...|   ||.                 
  Rat   376 ARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVF 440

  Fly   320 DFISPALSGFLD----------------------------------HYNLT-------WTIE--- 340
            .:.|..:|.|.|                                  :||.|       .::|   
  Rat   441 AYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFIL 505

  Fly   341 ------SIPPLDEIK---------------------LLYR---RLLMNETYQHPGKWHE------ 369
                  |.|.:|.::                     |.|:   :.|..|.:.  .||::      
  Rat   506 VQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEEAWH--SKWYDAKEANM 568

  Fly   370 --------------YHI-------------------KPTPIRT------------------DGS- 382
                          |.:                   |..|:.:                  ||: 
  Rat   569 EGIVTIMGLKPETRYAVRLAALNGKGLGEISAATEFKTQPVHSPPPQGEPSAPKLEGQMGEDGNS 633

  Fly   383 ----------------HFLMSY---------------------LVKNLEHNAVYEAIVQAKNKYG 410
                            |:|:.|                     ::|:|:.||.||..|.|:|:.|
  Rat   634 IKVNLIKQDDGGSPIRHYLVKYRAKLASEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQG 698

  Fly   411 WNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVSGIILSAFILVL 461
            .::.:.. .|.|......:..:.....|:|:.     .:.||::..|:|:|
  Rat   699 KSKAAHF-VFRTSAQPTAIPANGSPTAGLSTG-----AIVGILIVIFVLLL 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/84 (27%)
Ig 56..116 CDD:143165 17/60 (28%)
IG_like 144..221 CDD:214653 32/91 (35%)
IGc2 151..209 CDD:197706 26/72 (36%)
IG_like 232..313 CDD:214653 21/98 (21%)
Ig 242..311 CDD:143165 20/86 (23%)
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653 19/63 (30%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/5 (40%)
IgI_3_NCAM-1 211..308 CDD:143207 36/104 (35%)
Ig strand B 231..235 CDD:143207 3/3 (100%)
Ig strand C 244..248 CDD:143207 1/3 (33%)
Ig strand E 271..275 CDD:143207 2/3 (67%)
Ig strand F 285..290 CDD:143207 2/4 (50%)
Ig strand G 298..301 CDD:143207 1/5 (20%)
IgI_NCAM-1 307..413 CDD:143277 23/106 (22%)
Ig strand B 326..330 CDD:143277 2/3 (67%)
Ig strand C 339..343 CDD:143277 0/3 (0%)
Ig strand E 379..383 CDD:143277 2/3 (67%)
Ig strand F 393..398 CDD:143277 2/4 (50%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760 8/71 (11%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 0/3 (0%)
Ig strand F 487..492 CDD:409353 2/4 (50%)
FN3 509..606 CDD:238020 10/98 (10%)
fn3 619..701 CDD:394996 15/81 (19%)
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.