DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Ntm

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:305 Identity:79/305 - (25%)
Similarity:133/305 - (43%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLSLIGGSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRKGSSVLTAGH 83
            :|.|..|   :|......|.||.:..   ..|..||:..|.|.:.|..:.| .|...|::|.||:
Mouse    22 ALCLFQG---VPVRSGDATFPKAMDN---VTVRQGESATLRCTIDNRVTRV-AWLNRSTILYAGN 79

  Fly    84 LKITRDQRFKIVGD----YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNG 144
            .|...|.|..::.:    |:::|..|...|.|.|.|.: ..:|..:...|.::|..:.:.:..:.
Mouse    80 DKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSV-QTDNHPKTSRVHLIVQVSPKIVEISS 143

  Fly   145 QVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHL--------SDSSTLILENVDRHHAGTY 201
            .::..:|:.::|.|.|:|.|.||:.|         .|:        |:...|.::.:.|..:|.|
Mouse   144 DISINEGNNISLTCIATGRPEPTVTW---------RHISPKAVGFVSEDEYLEIQGITREQSGEY 199

  Fly   202 QCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQ-NSFLL 265
            :|||.|.|...|...:::|:..||.|: |........|....|.|......::|..|:: :..|:
Mouse   200 ECSASNDVAAPVVRRVKVTVNYPPYIS-EAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLV 263

  Fly   266 DATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYI 310
            :......:..|.....|...|....|:|||:|||.|.||.|...|
Mouse   264 EGKKGVKVENRPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/86 (28%)
Ig 56..116 CDD:143165 18/63 (29%)
IG_like 144..221 CDD:214653 21/84 (25%)
IGc2 151..209 CDD:197706 19/65 (29%)
IG_like 232..313 CDD:214653 21/80 (26%)
Ig 242..311 CDD:143165 20/70 (29%)
NtmNP_001344522.1 Ig 44..132 CDD:416386 24/92 (26%)
Ig strand A' 44..49 CDD:409353 1/7 (14%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 2/6 (33%)
Ig strand C 64..70 CDD:409353 2/6 (33%)
CDR2 71..83 CDD:409353 5/11 (45%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 9/34 (26%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/8 (38%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 1/8 (13%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 136..205 CDD:404760 18/77 (23%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand F 197..205 CDD:409353 5/7 (71%)
Ig_3 222..299 CDD:404760 20/77 (26%)
putative Ig strand A 223..229 CDD:409353 3/6 (50%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.