DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Siglecf

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_036008858.1 Gene:Siglecf / 233186 MGIID:2681107 Length:589 Species:Mus musculus


Alignment Length:317 Identity:73/317 - (23%)
Similarity:118/317 - (37%) Gaps:64/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGS----FVLLWRKGSSVLTAGHLKITRDQ---------RFKIVGDYN----- 99
            |..:.:.|:||...|    |...:|:|:::.:...:.....|         ||.::|..|     
Mouse    53 GLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCS 117

  Fly   100 LQINGVKTQDAGDYICQL-GDQENRDQVHTVEILVPPTLRALPHNGQVTAR--KGSTVTLECKA- 160
            |.|...:..|.|.|..:| |..:...|...:.:|| ..|..:| |.|||:.  .|::..|.|.. 
Mouse   118 LDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLV-I
ALTEVP-NIQVTSTLVSGNSTKLLCSVP 180

  Fly   161 ----SGNPVPTIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSAD-NGVKDRVSMDIQLT 220
                .|.| |...|....:.|.....:.||.|.|....:.:.....|..: .|....|....||:
Mouse   181 WACEQGTP-PIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLS 244

  Fly   221 IL-SPPEITVEKSW--------------VHASEGYDVELVCIVHGDVNSEMLW---YQNSFLLDA 267
            :: :|.::|:..||              :...||..:.|||:...:..:.:.|   .|..|.| :
Mouse   245 VIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWERPTQKPFQL-S 308

  Fly   268 TDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYIEVSGRP-----GPA 319
            |......||.:.          .|.|.|.|.|.|:.|.....:.:|.|.     ||:
Mouse   309 TPAELQLPRAEL----------EDQGKYICQAQNSQGAQTASVSLSIRSLLQLLGPS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 21/98 (21%)
Ig 56..116 CDD:143165 17/77 (22%)
IG_like 144..221 CDD:214653 20/84 (24%)
IGc2 151..209 CDD:197706 13/63 (21%)
IG_like 232..313 CDD:214653 21/97 (22%)
Ig 242..311 CDD:143165 17/71 (24%)
SiglecfXP_036008858.1 Ig 40..153 CDD:416386 23/100 (23%)
FR1 40..64 CDD:409353 3/10 (30%)
Ig strand A 40..44 CDD:409353
Ig strand A' 47..51 CDD:409353
Ig strand B 53..64 CDD:409353 3/10 (30%)
CDR1 65..70 CDD:409353 1/4 (25%)
FR2 71..78 CDD:409353 1/6 (17%)
Ig strand C 71..78 CDD:409353 1/6 (17%)
CDR2 79..102 CDD:409353 2/22 (9%)
Ig strand C' 89..92 CDD:409353 0/2 (0%)
FR3 103..136 CDD:409353 9/32 (28%)
Ig strand D 104..108 CDD:409353 2/3 (67%)
Ig strand E 114..122 CDD:409353 2/7 (29%)
Ig strand F 129..136 CDD:409353 2/6 (33%)
FR4 140..153 CDD:409353 3/13 (23%)
Ig strand G 140..153 CDD:409353 3/13 (23%)
Ig 159..243 CDD:416386 20/85 (24%)
Ig strand A 159..163 CDD:409353 2/4 (50%)
Ig strand B 172..178 CDD:409353 1/5 (20%)
Ig strand C 190..195 CDD:409353 1/4 (25%)
Ig strand E 209..215 CDD:409353 3/5 (60%)
Ig strand F 222..229 CDD:409353 1/6 (17%)
Ig strand G 236..243 CDD:409353 1/6 (17%)
IG 272..345 CDD:214652 19/83 (23%)
Ig 357..427 CDD:416386
Ig strand B 363..370 CDD:409353
Ig strand C 376..381 CDD:409353
Ig strand C' 383..386 CDD:409353
Ig strand D 395..402 CDD:409353
Ig strand E 405..412 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.