DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:399 Identity:105/399 - (26%)
Similarity:166/399 - (41%) Gaps:101/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLYLFSFSLSLIG-------GSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQN--LG 66
            ::.|:.:|..|:||       |:..|.|.      |:|::      ...||::.|.|.|.:  .|
Human     1 MIWYVATFIASVIGTRGLAAEGAHGLREE------PEFVT------ARAGESVVLRCDVIHPVTG 53

  Fly    67 S---FVLLWRK-GSSV---LTAG----HLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQ--LG 118
            .   :|:.|.| |..:   :..|    |:......|..:....:|::..|:::|.|.|.|:  :.
Human    54 QPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLML 118

  Fly   119 DQE-----NRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVF-- 176
            ||:     |...|| :.|..|||....|.. .:.|::|.::|:.|.|.|||.|.:.|.|:...  
Human   119 DQQYDTFHNGSWVH-LTINAPPTFTETPPQ-YIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLLG 181

  Fly   177 -SGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLT-----ILSPPE-ITVEKSWV 234
             ||...:||.| |.:.:|.|...|.|.|.|.:...:.|.....|.     |:|||| |||..|  
Human   182 ASGKYQVSDGS-LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNIS-- 243

  Fly   235 HASEGYDVELVCIVH---GDV------NSEMLWYQNS------FLLDATDRRSMYPRDDRYSLII 284
                 .|..|.|...   |::      ..|.:::||.      .|:|.|             |||
Human   244 -----QDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGT-------------LII 290

  Fly   285 RNFQPTDFGNYSCVADNALGR--------TKKY-IEVSGRPGPADFISPALSGFLDHYNLTWTIE 340
            ...:|.|.|.|:||..|:|||        |.:| ..|...| |..::...:.|:     :...::
Human   291 FRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMP-PVIYVPVGIHGY-----IRCPVD 349

  Fly   341 SIPPLDEIK 349
            :.||...:|
Human   350 AEPPATVVK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 25/102 (25%)
Ig 56..116 CDD:143165 16/72 (22%)
IG_like 144..221 CDD:214653 25/84 (30%)
IGc2 151..209 CDD:197706 22/60 (37%)
IG_like 232..313 CDD:214653 26/104 (25%)
Ig 242..311 CDD:143165 24/92 (26%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 21/90 (23%)
Ig 41..115 CDD:143165 17/73 (23%)
I-set 139..225 CDD:254352 27/87 (31%)
IGc2 153..210 CDD:197706 21/57 (37%)
I-set 229..321 CDD:254352 32/111 (29%)
Ig 235..321 CDD:299845 29/105 (28%)
IG_like 331..414 CDD:214653 6/34 (18%)
Ig <353..414 CDD:299845 2/6 (33%)
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.