DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Cilp

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_775561.1 Gene:Cilp / 214425 MGIID:2444507 Length:1250 Species:Mus musculus


Alignment Length:234 Identity:61/234 - (26%)
Similarity:94/234 - (40%) Gaps:58/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVG---DYNLQINGVKTQDAGDYICQL 117
            |.||......|:.|.|..|...:||    :.....||::.|   |....:...||:.|       
Mouse   230 ISLPGGGPAPGAAVYLLAKAPKMLT----RTDSSGRFRVPGLCPDGKTILKITKTKFA------- 283

  Fly   118 GDQENRDQVHTVEILVPPT-----------LRA-LPH---NGQVTARK-GSTVTLECKASGNPVP 166
                      .:.|.:|.|           :|| .|:   |.::.||: |.:|:|.|||:|.|.|
Mouse   284 ----------PIMITMPKTSLKSATINAEFVRAETPYIVMNPEMKARRAGQSVSLCCKATGKPSP 338

  Fly   167 -TIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN---GVKDRVSMDIQLTILSPPEI 227
             ..||:..:....|:.....|.|:|.|:.:..||.|.|.|.:   .||.:|:   |||:::..|.
Mouse   339 DKYFWYHNNTLLDPSLYKHESKLVLRNLQQDQAGEYFCKAQSDAGAVKSKVT---QLTVIAHDET 400

  Fly   228 TVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLD 266
            ....:    .|.|   |:.:.|....:.    .|||..|
Mouse   401 PCNPT----PESY---LIRLPHDCFQNA----SNSFYYD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 17/79 (22%)
Ig 56..116 CDD:143165 16/62 (26%)
IG_like 144..221 CDD:214653 28/81 (35%)
IGc2 151..209 CDD:197706 21/61 (34%)
IG_like 232..313 CDD:214653 8/35 (23%)
Ig 242..311 CDD:143165 6/25 (24%)
CilpNP_775561.1 Mucin2_WxxW 55..139 CDD:290069
TSP1 152..200 CDD:214559
IG_like 321..394 CDD:214653 26/75 (35%)
IGc2 323..383 CDD:197706 21/59 (36%)
CarbopepD_reg_2 492..580 CDD:290434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.