DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and zig-3

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:225 Identity:56/225 - (24%)
Similarity:88/225 - (39%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKK----------DVFS-- 177
            ::.:..:...|:|:.:......|...|.:|||.|.....|...|:|.|.          :||.  
 Worm    32 EIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYWEKDGQRIQGDKELNVFEKV 96

  Fly   178 ----GPTHLSD--SSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTI-----------LSPP 225
                |||..|.  :|:..:...:.||.|:|:|.|.|| .|.|....::::           .|.|
 Worm    97 LNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNG-HDTVESSAKISVEGQTVKCKSTRRSAP 160

  Fly   226 EITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLD-ATDRRSMYPRDDRYSLIIRNFQP 289
            .||:........:.....|:|  ..|..:...|......:| .:.|..:.|..|   |:||..|.
 Worm   161 VITMSTESRFELQDNAATLIC--RADRRANWNWMFEDKKIDFDSGRYELLPSGD---LLIRKIQW 220

  Fly   290 TDFGNYSCVADNALGR---------TKKYI 310
            :|.|:|.|:|.|..|.         |||:|
 Worm   221 SDMGSYFCIAHNKYGESRGETFLYPTKKHI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 0/7 (0%)
Ig 56..116 CDD:143165
IG_like 144..221 CDD:214653 27/94 (29%)
IGc2 151..209 CDD:197706 23/75 (31%)
IG_like 232..313 CDD:214653 23/89 (26%)
Ig 242..311 CDD:143165 23/79 (29%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 27/100 (27%)
Ig 61..142 CDD:143165 25/81 (31%)
IG_like 177..244 CDD:214653 19/71 (27%)
Ig <191..237 CDD:299845 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.