Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509336.1 | Gene: | zig-3 / 192088 | WormBaseID: | WBGene00006980 | Length: | 251 | Species: | Caenorhabditis elegans |
Alignment Length: | 225 | Identity: | 56/225 - (24%) |
---|---|---|---|
Similarity: | 88/225 - (39%) | Gaps: | 45/225 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 QVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKK----------DVFS-- 177
Fly 178 ----GPTHLSD--SSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTI-----------LSPP 225
Fly 226 EITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLD-ATDRRSMYPRDDRYSLIIRNFQP 289
Fly 290 TDFGNYSCVADNALGR---------TKKYI 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 0/7 (0%) |
Ig | 56..116 | CDD:143165 | |||
IG_like | 144..221 | CDD:214653 | 27/94 (29%) | ||
IGc2 | 151..209 | CDD:197706 | 23/75 (31%) | ||
IG_like | 232..313 | CDD:214653 | 23/89 (26%) | ||
Ig | 242..311 | CDD:143165 | 23/79 (29%) | ||
zig-3 | NP_509336.1 | I-set | 45..145 | CDD:254352 | 27/100 (27%) |
Ig | 61..142 | CDD:143165 | 25/81 (31%) | ||
IG_like | 177..244 | CDD:214653 | 19/71 (27%) | ||
Ig | <191..237 | CDD:299845 | 16/48 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |