Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 52/209 - (24%) |
---|---|---|---|
Similarity: | 80/209 - (38%) | Gaps: | 64/209 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 PHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSDSSTLILEN------------- 192
Fly 193 VDRHH---------AGTYQCSADNG--------------------VKDRVSMDIQLTILSPPEIT 228
Fly 229 VEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLL-DATDRRSMYPRDDRYSLIIRNFQPTDF 292
Fly 293 GNYSCVADNALGRT 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | |
Ig | 56..116 | CDD:143165 | |||
IG_like | 144..221 | CDD:214653 | 24/118 (20%) | ||
IGc2 | 151..209 | CDD:197706 | 20/99 (20%) | ||
IG_like | 232..313 | CDD:214653 | 24/76 (32%) | ||
Ig | 242..311 | CDD:143165 | 24/66 (36%) | ||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 23/100 (23%) |
Ig | 34..121 | CDD:299845 | 20/87 (23%) | ||
Ig | <179..232 | CDD:299845 | 20/51 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |