DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and zig-2

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:209 Identity:52/209 - (24%)
Similarity:80/209 - (38%) Gaps:64/209 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSDSSTLILEN------------- 192
            |::..||.  |....|.|.|:|.|:|:|:|    ..:|.....:.::.:.||             
 Worm    39 PNDSNVTF--GEKFVLSCGANGAPLPSIYW----ELNGMRIQGEETSNVYENILNDGKQVSNAAM 97

  Fly   193 VDRHH---------AGTYQCSADNG--------------------VKDRVSMDIQLTILSPPEIT 228
            |..|:         :|.|:|..|||                    :.|..:..|.:|:....||:
 Worm    98 VSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEIS 162

  Fly   229 VEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLL-DATDRRSMYPRDDRYSLIIRNFQPTDF 292
                      ...|.|.|  ..:..:|..|::...|| :..:|..|:|..|   |||||...:|.
 Worm   163 ----------NNAVALSC--RSETATEWSWHKGEQLLTNDGERYQMFPSGD---LIIRNISWSDM 212

  Fly   293 GNYSCVADNALGRT 306
            |.|:|.|.|..|.|
 Worm   213 GEYNCTARNHFGET 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653
Ig 56..116 CDD:143165
IG_like 144..221 CDD:214653 24/118 (20%)
IGc2 151..209 CDD:197706 20/99 (20%)
IG_like 232..313 CDD:214653 24/76 (32%)
Ig 242..311 CDD:143165 24/66 (36%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 23/100 (23%)
Ig 34..121 CDD:299845 20/87 (23%)
Ig <179..232 CDD:299845 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.