DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Dscam

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus


Alignment Length:455 Identity:103/455 - (22%)
Similarity:173/455 - (38%) Gaps:95/455 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGS--FVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQ 101
            |.|:......:..:|:.:.:||.|.: |.  ..:.|:|....:.|. |.:|.|   .|....:|:
Mouse   596 PPFIQPFEFPRFSIGQRVFIPCVVVS-GDLPITITWQKDGRPIPAS-LGVTID---NIDFTSSLR 655

  Fly   102 INGVKTQDAGDYICQLGDQENRDQVHTVE------ILVPPTLRALPHNGQVTARKGSTVTLECKA 160
            |:.:.....|:|.|..     |::...||      :.|||.....|.:..  ...|..|.|.|.|
Mouse   656 ISNLSLMHNGNYTCIA-----RNEAAAVEHQSQLIVRVPPKFVVQPRDQD--GIYGKAVILNCSA 713

  Fly   161 SGNPVPTIFW----------FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSM 215
            .|.|||||.|          |:....:|...:..:.:|::::|....:|.|.|...|.|...||.
Mouse   714 EGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSK 778

  Fly   216 DIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRY 280
            .:.||:..|..||...:...|::|...|:.|..||:....:.|.:...:::....|.:....:..
Mouse   779 SMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVG 843

  Fly   281 SLIIRNFQ--PT---DFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIE 340
            ..:|...|  ||   |.|.:||.|.|:.|..:..|:::.:..|.                     
Mouse   844 EEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPD--------------------- 887

  Fly   341 SIPPLDEIK-LLYRRLLMNETYQHPGKWHEYHIKPTPI------------------RT-DGSHFL 385
              ||..||| :..|.:.:..|....|.        :||                  || |.|..|
Mouse   888 --PPEIEIKDVKARTITLRWTMGFDGN--------SPITGYDIECKNKSDSWDSAQRTKDVSPQL 942

  Fly   386 MSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVS 450
            .|..:.::..::.|...:.|||:.|.:|.|         :::.:..|.....|....:.:.||.|
Mouse   943 NSATIIDIHPSSTYSIRMYAKNRIGKSEPS---------NEITITADEAAPDGPPQEVHLEPTSS 998

  Fly   451  450
            Mouse   999  998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 20/90 (22%)
Ig 56..116 CDD:143165 15/61 (25%)
IG_like 144..221 CDD:214653 24/86 (28%)
IGc2 151..209 CDD:197706 20/67 (30%)
IG_like 232..313 CDD:214653 20/85 (24%)
Ig 242..311 CDD:143165 17/73 (23%)
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706
IG 320..400 CDD:214652
Ig_3 410..488 CDD:372822
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229 22/99 (22%)
Ig_DSCAM 707..784 CDD:143211 23/76 (30%)
Ig 802..889 CDD:386229 20/109 (18%)
FN3 885..978 CDD:238020 24/132 (18%)
FN3 986..1083 CDD:238020 4/13 (31%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.