DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Cd33

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001104528.1 Gene:Cd33 / 12489 MGIID:99440 Length:403 Species:Mus musculus


Alignment Length:292 Identity:66/292 - (22%)
Similarity:105/292 - (35%) Gaps:83/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTLVLYLFSFSLSLIGGSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKV------QNLGS 67
            |.|.|:|      |..|| :..:.:....||:.::      |..|..:.:||.|      ..||.
Mouse     3 WPLPLFL------LCAGS-LAQDLEFQLVAPESVT------VEEGLCVHVPCSVFYPSIKLTLGP 54

  Fly    68 FVLLW-RKG------SSVLTAGHLKITR---DQRFKIVG-----DYNLQINGVKTQDAGDYICQL 117
            ....| |||      |.|.|:...::.:   ..||:::|     |.:|.|...:..|.|.|..::
Mouse    55 VTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRV 119

  Fly   118 --------GDQENRDQVH------TVEILVPPTLRALPHNGQVTARKGSTVTLECKA-----SGN 163
                    ..::::..:|      |.:|::|.||.|           |....|.|..     .|.
Mouse   120 VREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEA-----------GYPSNLTCSVPWACEQGT 173

  Fly   164 PVPTIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEIT 228
            | ||..|....:.|..:..:|||.|......:.|.....|               |...|...:|
Mouse   174 P-PTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTC---------------LVTFSGAGVT 222

  Fly   229 VEKSW---VHASEGYDVELVCIVHGDVNSEML 257
            ||::.   |....|...|||.:..|:...::|
Mouse   223 VERTIQLNVTRKSGQMRELVLVAVGEATVKLL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/117 (22%)
Ig 56..116 CDD:143165 21/80 (26%)
IG_like 144..221 CDD:214653 16/81 (20%)
IGc2 151..209 CDD:197706 15/62 (24%)
IG_like 232..313 CDD:214653 7/29 (24%)
Ig 242..311 CDD:143165 5/16 (31%)
Cd33NP_001104528.1 Ig 21..139 CDD:299845 26/123 (21%)
IG_like 26..119 CDD:214653 24/98 (24%)
Ig 150..214 CDD:299845 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.