DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and igsf9b

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031761656.1 Gene:igsf9b / 100379858 XenbaseID:XB-GENE-5887265 Length:1392 Species:Xenopus tropicalis


Alignment Length:407 Identity:104/407 - (25%)
Similarity:159/407 - (39%) Gaps:117/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLYLFSFSLSLI----------GGSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNL 65
            ::.|:.:...|:|          |||         ...|:|::......||:|..:..|..||. 
 Frog     1 MIWYVLTLIASVISTLGLSVQGAGGS---------REEPQFVTARAGESVILGCDVVHPLTVQP- 55

  Fly    66 GSFVLLWRK-GSSV---LTAG----HLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQEN 122
            ..:|:.|.| |..:   :..|    |:......|..:....:|:|..|::||.|.|.|::...|:
 Frog    56 PPYVVEWFKFGVPIPIFIKFGFYPPHVDPEYVGRAALYDKASLRIEQVRSQDQGWYECKVLMLEH 120

  Fly   123 R-DQVHT-----VEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPT- 180
            : |..|.     :.:..|||....|.. .:..::||::||.|.|.|||.||:.|.::..|.|.| 
 Frog   121 QYDTFHNGSWVHLTVNAPPTFTETPPQ-YLEVKEGSSITLTCTAFGNPKPTVSWLREGEFLGRTS 184

  Fly   181 --HLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLT-----ILSPPE-ITVEKSWVHAS 237
              .|||.| |.:.::.|...|:|.|.|.:...:.|.....|.     |:|||| |||..|     
 Frog   185 KYQLSDGS-LTISSIGREDRGSYMCRATSIQGEAVHSTRLLVQGSPFIVSPPENITVNIS----- 243

  Fly   238 EGYDVELVCIVHG-DVNSEMLWY---QNSF-----------LLDATDRRSMYPRDDRYSLIIRNF 287
              .|....|.... ..|....||   :|.|           |:|.|             |||...
 Frog   244 --QDALFTCQAEAYPGNLTYTWYWQEENVFFKNDLKLRVRILIDGT-------------LIIFRV 293

  Fly   288 QPTDFGNYSCVADNALGRTKKYIEVSGRPGPADFISPALSGFLD--------------------H 332
            :|.|.|.|:||..|:|||                 ||:.|.:|.                    |
 Frog   294 KPEDAGKYTCVPSNSLGR-----------------SPSASAYLTVQYPARVVNMPPVIYVPVGIH 341

  Fly   333 YNLTWTIESIPPLDEIK 349
            .::...:|::||:..:|
 Frog   342 GHIRCPVEAVPPVTFVK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/96 (25%)
Ig 56..116 CDD:143165 17/67 (25%)
IG_like 144..221 CDD:214653 27/84 (32%)
IGc2 151..209 CDD:197706 25/60 (42%)
IG_like 232..313 CDD:214653 24/95 (25%)
Ig 242..311 CDD:143165 22/83 (27%)
igsf9bXP_031761656.1 IG 30..115 CDD:214652 23/85 (27%)
I-set 139..225 CDD:400151 29/87 (33%)
Ig strand A 139..142 CDD:409353 2/2 (100%)
Ig strand A' 148..151 CDD:409353 0/2 (0%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand D 185..189 CDD:409353 0/3 (0%)
Ig strand E 191..195 CDD:409353 2/4 (50%)
Ig strand F 204..212 CDD:409353 4/7 (57%)
Ig strand G 215..225 CDD:409353 1/9 (11%)
I-set 229..321 CDD:400151 36/128 (28%)
Ig strand B 246..250 CDD:409353 0/3 (0%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/16 (13%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Ig 344..405 CDD:409353 4/15 (27%)
Ig strand C 355..360 CDD:409353 1/4 (25%)
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig 429..505 CDD:416386
Ig strand A' 429..432 CDD:409353
Ig strand B 438..445 CDD:409353
Ig strand C 451..456 CDD:409353
Ig strand C' 458..460 CDD:409353
Ig strand E 471..476 CDD:409353
Ig strand F 484..492 CDD:409353
Ig strand G 495..505 CDD:409353
FN3 510..605 CDD:238020
FN3 622..703 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.