| Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 305 | Identity: | 81/305 - (26%) |
|---|---|---|---|
| Similarity: | 134/305 - (43%) | Gaps: | 46/305 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 GETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIV----GDYNLQINGVKTQDAGDY 113
Fly 114 ICQLGDQENRD--QVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVF 176
Fly 177 SGPTHLSDSST-------LILENVDRHHAGTYQCSADNGV------KDRVSMDIQLTIL--SPPE 226
Fly 227 ITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRR-SMYPRDDRYSLIIRNFQPT 290
Fly 291 DFGNYSCVADNALGRTKKYIEVSG--RPGPADFISPALSGFLDHY 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 26/85 (31%) |
| Ig | 56..116 | CDD:143165 | 19/63 (30%) | ||
| IG_like | 144..221 | CDD:214653 | 26/89 (29%) | ||
| IGc2 | 151..209 | CDD:197706 | 22/64 (34%) | ||
| IG_like | 232..313 | CDD:214653 | 20/81 (25%) | ||
| Ig | 242..311 | CDD:143165 | 19/69 (28%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 26/83 (31%) |
| FR1 | 44..62 | CDD:409353 | 4/7 (57%) | ||
| Ig strand A' | 47..53 | CDD:409353 | |||
| Ig strand B | 55..63 | CDD:409353 | 4/7 (57%) | ||
| CDR1 | 63..68 | CDD:409353 | 1/5 (20%) | ||
| FR2 | 69..75 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
| CDR2 | 76..87 | CDD:409353 | 5/10 (50%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 88..122 | CDD:409353 | 11/33 (33%) | ||
| Ig strand D | 91..98 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 101..107 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 127..136 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 129..136 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 140..208 | CDD:404760 | 23/78 (29%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 157..164 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 170..175 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 187..193 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 200..207 | CDD:409353 | 4/6 (67%) | ||
| Ig strand G | 214..222 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 226..302 | CDD:404760 | 21/84 (25%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 255..259 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 3/4 (75%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.000 | |||||