DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and lsamp

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:359 Identity:94/359 - (26%)
Similarity:147/359 - (40%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKI----VGDYNLQINGVKTQDAGDY 113
            |:|..|.|.|::..|.| .|...|.::.||..|.:.|.|.::    :.:|:|:|..|...|.|.|
 Frog    46 GDTAILRCFVEDRSSRV-AWLNRSGIIFAGDDKWSLDPRVELEKRSLLEYSLRIQKVDVSDEGPY 109

  Fly   114 ICQLGDQEN--RDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVF 176
            .|.:..:::  ..||:.: :.|||.:..:  :..:|..:||.|||.|.|.|.|.|.|.|......
 Frog   110 TCSVQTKQHTKTTQVYLI-V
QVPPKISNI--SADITVNEGSNVTLMCIAYGRPEPMITWRHLTPT 171

  Fly   177 SGPTHLSD----SSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHAS 237
            :|.:...|    ...|.::.:.|..:|.|:|.|.|.|.......:::|:..||.||..|| ..|:
 Frog   172 AGTSPARDFEGEEEFLEIQGITREQSGRYECKAAN
EVASADVKQVRVTVNYPPIITESKS-NEAT 235

  Fly   238 EGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRR-------SMYPRDDRYSLIIRNFQPTDFGNY 295
            .|....|.|........:..||::    |...||       .:.....|..|::.|.....:|||
 Frog   236 TGKQAILRCEASAVPAPDFEWYKD----DTRSRRINSAQGLEIRNTGSRSVLMVANVTEEHYGNY 296

  Fly   296 SCVADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIESIPPLDEIKLLYRRLLMNET 360
            :|||.|.||.|...:.:..|..|...:|.:..|...||                           
 Frog   297 TCVAANKLGITNTSLYLYKRVSPTKPMSASERGSNVHY--------------------------- 334

  Fly   361 YQHPGKWHEYHIKP-TPIRTDGSHFLMSYLVKNL 393
                    :|.:.| |||.:..|.....:|:.||
 Frog   335 --------QYKVGPGTPIDSATSLAASLWLMANL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/85 (28%)
Ig 56..116 CDD:143165 19/63 (30%)
IG_like 144..221 CDD:214653 23/80 (29%)
IGc2 151..209 CDD:197706 21/61 (34%)
IG_like 232..313 CDD:214653 23/87 (26%)
Ig 242..311 CDD:143165 20/75 (27%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 24/83 (29%)
FR1 38..54 CDD:409353 3/7 (43%)
Ig strand A' 39..45 CDD:409353
Ig strand B 47..55 CDD:409353 3/7 (43%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 3/7 (43%)
Ig strand C 60..66 CDD:409353 3/6 (50%)
CDR2 68..78 CDD:409353 3/9 (33%)
Ig strand C' 70..73 CDD:409353 0/2 (0%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 10/34 (29%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 2/5 (40%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 0/3 (0%)
Ig strand G 119..128 CDD:409353 2/9 (22%)
FR4 121..128 CDD:409353 2/7 (29%)
Ig_3 131..206 CDD:404760 23/76 (30%)
Ig strand A' 138..143 CDD:409353 0/4 (0%)
Ig strand B 149..156 CDD:409353 4/6 (67%)
Ig strand C 162..167 CDD:409353 2/4 (50%)
Ig strand C' 173..175 CDD:409353 1/1 (100%)
Ig strand E 185..191 CDD:409353 1/5 (20%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 0/7 (0%)
Ig_3 223..302 CDD:404760 24/83 (29%)
putative Ig strand A 224..230 CDD:409353 3/5 (60%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 3/4 (75%)
Ig strand G 308..311 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.