DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRP6 and Culd

DIOPT Version :9

Sequence 1:NP_002327.2 Gene:LRP6 / 4040 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster


Alignment Length:938 Identity:191/938 - (20%)
Similarity:270/938 - (28%) Gaps:378/938 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   839 TQYQDYIYWTDW-SRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSG--WNECASSNGHC 900
            :.|:|......| .||........:|:..........|....|||.:...:|  |.:|:.....|
  Fly    30 SSYRDLDICNHWDGRRHFLELGSPAGEVHARNVTTTAYRSSPLVFKNDAVAGDVWYQCSLELVTC 94

Human   901 SHLCLAVP------------VGG--FVCGC-------PAHYSLNADNRTCSAPTTF--------L 936
            :...:.|.            .||  .:|.|       |.:.|..:....|.....|        |
  Fly    95 AECVIRVAFTYANFSKSCGNTGGKSSMCPCEHIQFSEPPYDSTISGQEFCGDGKVFRSKTRTLQL 159

Human   937 LFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFT 1001
            .|..: |.|..|..        |...|.||||.:...|          :|:::    .:||....
  Fly   160 KFFYR-ASNAHVFS--------LQYFSERNVRIVSGSP----------KQSIV----GNGSTKSQ 201

Human  1002 VVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGR--------------SVGVVL 1052
            ..|.|.|...: ..|.|..|:    :|. ||||.|.  ..|||..              |.|.:|
  Fly   202 PQVISTPYFPM-AYPRDYGIE----HIL-TCEADNC--QVRLDFTDFQLGLTSTLEIFDSNGQML 258

Human  1053 ---KGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLG 1114
               .||..|| .:.|:..|..:    ||.|.   ..|...|...||.|.|  ||.:         
  Fly   259 DSYTGEHFRP-PITVSSGKSLL----LQFRG---NSATGVGFRAEVSFVS--SKQL--------- 304

Human  1115 KLFWADSDLRRIESSDLSGANRIVLEDSNILQPVG----LTVFEN----------WL------YW 1159
                  .|.|.:..:|..|.         :..|.|    :.:.||          |:      |.
  Fly   305 ------KDERLVPYTDCGGM---------VTGPGGAITMMNMIENATDVRLFDCIWIIKPGNNYM 354

Human  1160 IDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGC---SHIC--- 1218
            :.|....:...|..|...|:::..|....||  ||:..|:.        ..|.|.   ||:.   
  Fly   355 MMKTHISLRVDDFYGMAARSELTIRQGTTSD--AVEIENVM--------WPNNGLSKESHVAPIL 409

Human  1219 ---LVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHS 1280
               .::..|....|..:.:|                  ::.|                       
  Fly   410 NGYYIRLRGVFGMSSKLAIV------------------YSVF----------------------- 433

Human  1281 DELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDE-KNCE-------------------VL 1325
            :.|||.:.||  |.|.:..||...|.|:|..:|.|.||| .:||                   ..
  Fly   434 NYLNCYIGSE--FLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYF 496

Human  1326 CLIDQF---RCANGQCI-----------------------GKHKK--CDHNVDCS---DKSDELD 1359
            ..|||:   :.|.|..|                       .:|::  ..|....|   |:.|| |
  Fly   497 PKIDQYPDLKTATGIFIISTLGIFGVLSGWMVILYRMGVRARHQRELQSHLQTISELLDRQDE-D 560

Human  1360 CYPTEEP-------------------------------AP--------QATN-TVGSVI------ 1378
            ..|.|.|                               ||        .|:| ||.||:      
  Fly   561 RTPDEPPSYEAPPDYEEVIKVGMQQELREPRRQRRARRAPPRDRSCSRAASNCTVQSVLPLHRSC 625

Human  1379 ------------GVIVTIFVSGT--------VYFICQRML-----C-------PRMKGDGETMTN 1411
                        ...:|..|:.|        |..:.||||     |       |..|..|:.:.:
  Fly   626 TLERDQEQPSTSAAAMTHAVAATDTTEDAEHVQTMAQRMLLATAICGTAGTSLPAAKESGQRVQS 690

Human  1412 DYVVHGPASVPLGYVPHPSSLS--GSLPGMSRGKSMISSLSIMGGSSGPPYDRAH--VTGASSSS 1472
                       :|....|||||  |.||             ..|||:..|...|.  ..|..|.|
  Fly   691 -----------VGISTSPSSLSAGGELP-------------TAGGSATTPGSTADECTQGGDSLS 731

Human  1473 SSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPS------THRSYSYRPYSYRHFAPPTTP 1531
            .|.|.|.         ||...|....|.:......||.      |..::..|.:......||   
  Fly   732 ISLTLGL---------PSTTAESPVTTDQNQLQKQSPEQTISNCTEHTFLKRSWLVVQQVPP--- 784

Human  1532 CSTDVCDSDYAPSRRMTSVATAKGYTSD 1559
                  ...|...|...:.::.:.:|||
  Fly   785 ------GRGYRVRRLRHTFSSPEAFTSD 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275
NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890 11/53 (21%)
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531 6/27 (22%)
FXa_inhibition 893..929 CDD:291342 9/56 (16%)
Beta-propeller 4 933..1202 71/313 (23%)
LY 958..998 CDD:214531 9/39 (23%)
Ldl_recept_b 1069..1110 CDD:278487 11/40 (28%)
LY 1094..1136 CDD:214531 10/41 (24%)
FXa_inhibition 1207..1243 CDD:291342 7/44 (16%)
LDLa 1249..1285 CDD:238060 2/35 (6%)
LDLa 1288..1322 CDD:238060 14/34 (41%)
LDLa 1326..1360 CDD:238060 12/64 (19%)
PPPSP motif A 1487..1493 2/5 (40%)
PPPSP motif B 1527..1534 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1556..1613 3/4 (75%)
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
CuldNP_729364.1 CUB 200..298 CDD:238001 31/113 (27%)
LDLa 442..472 CDD:238060 14/31 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24270
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.