DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S1P and AT1G32980

DIOPT Version :10

Sequence 1:NP_649337.2 Gene:S1P / 40399 FlyBaseID:FBgn0037105 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_174574.2 Gene:AT1G32980 / 840193 AraportID:AT1G32980 Length:190 Species:Arabidopsis thaliana


Alignment Length:96 Identity:27/96 - (28%)
Similarity:42/96 - (43%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 SGTSVSSPVVAGAAALLISGAFQKIDYINPASLKQVLIEGA----------------EKLPHYNM 410
            ||||:|:|.|||..|||.|    ...:.:||:::..::..|                .||.  :.
plant     3 SGTSMSTPFVAGIVALLKS----LHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLA--DP 61

  Fly   411 FEQGAGKLNLLKSMQLLLSYKPKITLIPAYL 441
            |:.|.|.:|..|:.:..|.|...:.....||
plant    62 FDYGGGVVNSEKAAKPGLVYDMGVNDYVLYL 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S1PNP_649337.2 Peptidases_S8_SKI-1_like 154..407 CDD:173805 18/60 (30%)
DUF4350 610..754 CDD:464118
AT1G32980NP_174574.2 Peptidases_S8_S53 <1..40 CDD:415849 15/40 (38%)
AprE <3..89 CDD:441014 25/91 (27%)
fn3_6 121..>188 CDD:465493
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.