DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S1P and amon

DIOPT Version :10

Sequence 1:NP_649337.2 Gene:S1P / 40399 FlyBaseID:FBgn0037105 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster


Alignment Length:41 Identity:13/41 - (31%)
Similarity:19/41 - (46%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 KHIHYEDENSRYITIGCVEKALCMLACWVEDPNGIHFKKHL 330
            :||.||        .|.::|..|:: |......|.|.|:||
  Fly   507 RHIRYE--------CGGMKKFRCVM-CGKAFSQGSHLKRHL 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S1PNP_649337.2 Peptidases_S8_SKI-1_like 154..407 CDD:173805 13/41 (32%)
DUF4350 610..754 CDD:464118
amonNP_477318.1 S8_pro-domain 43..122 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 150..446 CDD:173789
Peptidases_S8_S53 <409..485 CDD:415849
P_proprotein 534..621 CDD:460225 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.