DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S1P and Rspo2

DIOPT Version :10

Sequence 1:NP_649337.2 Gene:S1P / 40399 FlyBaseID:FBgn0037105 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_001344886.1 Gene:Rspo2 / 239405 MGIID:1922667 Length:250 Species:Mus musculus


Alignment Length:38 Identity:12/38 - (31%)
Similarity:20/38 - (52%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LDIVTYGSQVEGS----DVRKGCRRLSGTSVSSPVVAG 373
            |:.:.| ||.:|:    :.|.|.|....:.||:|:..|
Mouse    13 LNCMDY-SQCQGNRWRRNKRGGSRSAEASYVSNPICKG 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S1PNP_649337.2 Peptidases_S8_SKI-1_like 154..407 CDD:173805 12/38 (32%)
DUF4350 610..754 CDD:464118
Rspo2NP_001344886.1 Furin-like_2 47..148 CDD:464939 1/3 (33%)
TSP1_spondin 152..205 CDD:480609
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.