DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfAP-2 and si:ch73-127m5.2

DIOPT Version :9

Sequence 1:NP_001262178.1 Gene:TfAP-2 / 40398 FlyBaseID:FBgn0261953 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001265527.1 Gene:si:ch73-127m5.2 / 561202 ZFINID:ZDB-GENE-030131-1052 Length:393 Species:Danio rerio


Alignment Length:404 Identity:85/404 - (21%)
Similarity:139/404 - (34%) Gaps:108/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PATGHSGHSSTHGSAATMHHQSLQSDFQPPYFPPPFHHSTQSPPQQQISGYLQNHGALEYLGTDP 114
            |:.|.  |.|.......:.|.|:.:.....|.|        .|..|.|:..:..|...:.:....
Zfish     3 PSAGM--HMSAVPQNTEVVHVSVANPIITMYQP--------QPQPQNIAQIITQHVLPQEVSCQA 57

  Fly   115 YGQPLSSLHHAPLHHYNQLAGLRSTQDQLGIH-RTHREAELQGHVTQLSHGFPYTDRRSDYGSAI 178
            ....:.|..|.|.|          .|.|..|. ..|.:...|.||...:|..|       .|..:
Zfish    58 VPHTMQSHVHMPTH----------IQTQSHIQPAPHLQTPPQVHVEAQTHIPP-------QGHML 105

  Fly   179 SAGAAHGTRLGHEHESLALHQALQNAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNIGSGSP 243
            :.|.:.|       :|.|..|.  .||:.:|.|..:  ||.:.|    .:|||.|          
Zfish   106 TQGPSEG-------QSAAPSQG--GAVNSLQVPFAE--VASLLD----PNMKSSK---------- 145

  Fly   244 SEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKI 308
                            ..||::...||:|||.|||.::...|....|.::.....:.|.|.|...
Zfish   146 ----------------ARKYQIHYEEVKRRLEPPEKMSLRSLAAYTRVSRGPASKKTLLESLNVF 194

  Fly   309 GLNLPAGRRKAANVTLLTSLVEGEATHLAKD-----FHFVCETEFPARQLAEYI--VRHQTEPQD 366
            ||:.......:::.:.||   ||:...|.||     ..:| :.|..|:||....  |:|.::   
Zfish   195 GLSPSTNTAVSSSFSKLT---EGDTAALCKDMKDFALQYV-DYENMAKQLLPETNQVQHWSK--- 252

  Fly   367 SYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVL 431
                   |:.::...:|:.:|.:....|..                  ||.:|||.|:..:...|
Zfish   253 -------IIETRNYLEEMRKIFNDPLNTRL------------------FSNVTHGLGNGMMDVAL 292

  Fly   432 HAFQTFLNESLNYL 445
            ....:.::..:..|
Zfish   293 DIIDSVIDRQIRIL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfAP-2NP_001262178.1 TF_AP-2 247..441 CDD:397406 42/200 (21%)
si:ch73-127m5.2NP_001265527.1 TF_AP-2 144..306 CDD:281315 43/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.