DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfAP-2 and aptf-1

DIOPT Version :9

Sequence 1:NP_001262178.1 Gene:TfAP-2 / 40398 FlyBaseID:FBgn0261953 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_495300.2 Gene:aptf-1 / 187043 WormBaseID:WBGene00019424 Length:365 Species:Caenorhabditis elegans


Alignment Length:212 Identity:111/212 - (52%)
Similarity:160/212 - (75%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIG 309
            ||:|.||||.||||||:||:||:||:|||:|||||||||||||:||:||||:||:.||:.|:|:|
 Worm   152 EVYCTVPGRTSLLSSTTKYRVTVAEIQRRISPPECLNASLLGGILRKAKSKDGGKTLRDSLKKLG 216

  Fly   310 LNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRHQ--TEPQDSYRRKE 372
            |.|||||||.||||..|:|||.||.|:||:|..|||.||.:|::..|:.:..  .:| |..:|:.
 Worm   217 LTLPAGRRKQANVTAWTALVEEEAIHMAKEFALVCEKEFHSREIGIYLTKTSLAIDP-DVVKRRT 280

  Fly   373 LILHSQQITKELMQILSQDRT--THFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQ 435
            .:..|:::..||.::||.|||  |.:..|:...::||:|:||:||:|:|||||:.|:.|||.:.:
 Worm   281 ALEMSRKVVGELAELLSCDRTPLTPYFPRNMLPIDPSVQQHLSHFTLMTHGFGNVAMSAVLESVK 345

  Fly   436 TFLNESLNYLEKLYPSN 452
            ..::||:.|:::....|
 Worm   346 LMIDESIKYIDRCCSQN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfAP-2NP_001262178.1 TF_AP-2 247..441 CDD:397406 105/197 (53%)
aptf-1NP_495300.2 TF_AP-2 152..355 CDD:281315 109/203 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167680
Domainoid 1 1.000 211 1.000 Domainoid score I1632
eggNOG 1 0.900 - - E1_KOG3811
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287275at33208
OrthoFinder 1 1.000 - - FOG0000991
OrthoInspector 1 1.000 - - oto18538
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10438
SonicParanoid 1 1.000 - - X400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.