DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and SMC1

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_116647.1 Gene:SMC1 / 850540 SGDID:S000001886 Length:1225 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:43/223 - (19%)
Similarity:82/223 - (36%) Gaps:63/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAGFVLIFVLGLVSSSWGFLEHDSWITV---------ELQHSLAANS-ESFSFRGNVTIPSLNSG 58
            |||.:...:.|..::.|...|:.|.:::         ||.:...:|| .:.....:|::  |||.
Yeast   661 KAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSL--LNSD 723

  Fly    59 LANVE----------------------------QP----------DLSTADLDLLK-KLALGNEF 84
            :||:.                            ||          ||.....:|:| |.||.|..
Yeast   724 IANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEKEALQNNI 788

  Fly    85 YRLKATVV------YSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVSQ---DTAP 140
            ::...:.:      |.|.:.......:|..:.||.|   :|.|..:.......::.:|   :.|.
Yeast   789 FKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQ---ILTVENKLQFETDRLSTTQRRYEKAQ 850

  Fly   141 ATIECTQEDVNKLLETQFSTDVLIRHAE 168
            ..:|..|.::..|.|.:::.::.|...|
Yeast   851 KDLENAQVEMKSLEEQEYAIEMKIGSIE 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
SMC1NP_116647.1 Smc 3..1225 CDD:224117 43/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.