DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and SMC6

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011531409.1 Gene:SMC6 / 79677 HGNCID:20466 Length:1110 Species:Homo sapiens


Alignment Length:228 Identity:45/228 - (19%)
Similarity:78/228 - (34%) Gaps:75/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVLIFVLGLVSSSWGFLEHD-SWITV-ELQHSLAANSESFSFRGNVTIPS--------------- 54
            |..|..|..:.::...|:|: :|..| |::..|.|      .|.|:.|..               
Human   258 FQSIAGLSTMKTNLESLKHEMAWAVVNEIEKQLNA------IRDNIKIGEDRAARLDRKMEEQQV 316

  Fly    55 -LN----------------SGLANVEQPDLSTADLDLLKKLALGNEFYRLKATVVYS---NGAKA 99
             ||                |...|...|:......|::.|....||     |.|:|:   |..||
Human   317 RLNEAEQKYKDIQDKLEKISEETNARAPECMALKADVVAKKRAYNE-----AEVLYNRSLNEYKA 376

  Fly   100 QFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVS--QDTAPATIECTQEDVNKLLETQFSTDV 162
            ......:.|:.:: :|......||||........:|  ::...| .:..:..||:.:|.      
Human   377 LKKDDEQLCKRIE-ELKKSTDQSLEPERLERQKKISWLKERVKA-FQNQENSVNQEIEQ------ 433

  Fly   163 LIRHAELAPVPDTAGFIQKVEREREARERGEVR 195
                           |.|.:|:::|  |.|:::
Human   434 ---------------FQQAIEKDKE--EHGKIK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
SMC6XP_011531409.1 Smc 48..1088 CDD:224117 45/228 (20%)
ABC_SMC6_euk 48..>204 CDD:213243
Fib_alpha <662..742 CDD:285864
DUF5098 701..>835 CDD:293628
ABC_SMC6_euk <996..1094 CDD:213243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.