DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and smc5

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001180470.1 Gene:smc5 / 566749 ZFINID:ZDB-GENE-061013-288 Length:1073 Species:Danio rerio


Alignment Length:175 Identity:35/175 - (20%)
Similarity:65/175 - (37%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPSLNSGLANV--EQPDLSTADLDLLK-KLALGNEFYRLKATV--------VYSNGAKAQFITSN 105
            |.::|:.|.|:  |:..|.:..|||.: |..:..||.||:..:        :.....:::|..:.
Zfish   389 IEAINAELRNIQEERARLESESLDLRRDKDEITGEFARLQNRLRSLDDMMKIKEEKLRSRFRDTY 453

  Fly   106 KACRLLQAQLNDVLWVSLEPSGYVTGIT-----------VSQDTAPATIECTQEDVNKLLETQFS 159
            .|...|:...:....|..||...|..:.           :|.:...|.:...|:|.:|.:.....
Zfish   454 TALEWLRKNRDRYEGVVHEPMMLVINVRDARHAKYIETHISVNDLRAFVFQRQDDNDKFMNEMRD 518

  Fly   160 TDVLIRHAELAPVPDTA--------------GFIQKVEREREARE 190
            |..|..::.:||....:              |||..:....:|.|
Zfish   519 TQRLRVNSIIAPTESCSKRPPSRPIETLKPYGFISYLREMFDAPE 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
smc5NP_001180470.1 ABC_SMC5_euk 40..>185 CDD:213244
Smc 42..1030 CDD:224117 35/175 (20%)
ABC_SMC5_euk <950..1052 CDD:213244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.