DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and jnj

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_651228.1 Gene:jnj / 42876 FlyBaseID:FBgn0266282 Length:1122 Species:Drosophila melanogaster


Alignment Length:124 Identity:31/124 - (25%)
Similarity:50/124 - (40%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGNEFYRLKATVVYSNG-AKAQFITSNKACRLLQAQLNDVLWVSLEPS---GYVTGITVSQDTAP 140
            ||.|:.......|||.. ..|::|..|...|:.|.|:........|||   .|:....|.::|..
  Fly   691 LGLEYIPSPNYAVYSTRITPARYIQKNVDDRIRQLQMEQSDLQEKEPSLEIDYMQHKKVLENTQK 755

  Fly   141 ATIECT----------QEDVNKLLETQ-FSTDVLIRHAEL-APVPDTAGFIQKVERERE 187
            ...:.:          |:.:.|::|.| |....|..:..| :.:.|:...|:|...|||
  Fly   756 VISQKSTMIGQHQSRNQKAMQKIMELQNFDYQELPEYDRLKSHLADSGEKIEKCRLERE 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
jnjNP_651228.1 ABC_SMC6_euk 99..>248 CDD:213243
Smc 115..1084 CDD:224117 31/124 (25%)
TEX15 <269..>357 CDD:291972
ABC_SMC6_euk <1027..1122 CDD:213243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.