DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and SMC1

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_651211.2 Gene:SMC1 / 42853 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster


Alignment Length:143 Identity:31/143 - (21%)
Similarity:56/143 - (39%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LALGNEFYRLKATVVYSNGA-----KAQFITSNKACRL------LQAQLNDVLWVSLEPSGYVT- 130
            |||...||:....:  |.|:     ||:........:|      ||.:|.:::..|.:.|...| 
  Fly   665 LALDGTFYQKSGLI--SGGSHDLARKAKRWDEKHMAQLKMQKERLQEELKELVKKSRKQSELATV 727

  Fly   131 -----GITVSQDTAPATIECTQEDV----NKLLETQFSTDVLIRHAELAPVPDTAGFIQKVERER 186
                 |:......:...:|.:::.:    |:|.:.|...|      |..|.      |.::||..
  Fly   728 ESQIKGLENRLKYSMVDLESSKKSISQYDNQLQQVQSQLD------EFGPK------ILEIERRM 780

  Fly   187 EARER--GEVRDN 197
            :.||.  .|:::|
  Fly   781 QNREEHIQEIKEN 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
SMC1NP_651211.2 Smc 26..1216 CDD:224117 31/143 (22%)
ABC_SMC1_euk 27..>171 CDD:213242
SMC_hinge 535..653 CDD:214944
DUF4700 <697..>810 CDD:292399 22/109 (20%)
ABC_SMC1_euk <1130..1232 CDD:213242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.