DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and emc10

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_988902.1 Gene:emc10 / 394497 XenbaseID:XB-GENE-5788294 Length:263 Species:Xenopus tropicalis


Alignment Length:205 Identity:68/205 - (33%)
Similarity:116/205 - (56%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VELQHSLAA-NSESFSFRGNVTIPSLNSGLA----NVEQPDLSTADLDLLKKLALGNEFYRLKAT 90
            :||:||... :|..|..||::    :.||.|    ::.|..|:..:.:.|:.:|..|..||::..
 Frog    56 LELEHSFELDDSIHFKKRGSL----IWSGTAEQSISILQKQLTEDERNKLRDIANLNGLYRIRVP 116

  Fly    91 VVYSNGAKA-QFITS-NKACRLLQAQLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKL 153
            .......:| :::|| .:||.::::.|:|.:.|..:.||.|.||::.  |.|.:  |...:|..:
 Frog   117 RKLGITEEANEYVTSFVRACSMVESHLSDQISVHTDISGNVVGISIV--TFPGS--CNGAEVEDV 177

  Fly   154 LETQFSTDVLIRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVVLLVFIS 218
            ....|:|.|.|:....|.||:||.||:::|.| :|::....::.:.|||||||||:||||.:.:|
 Frog   178 DLEMFNTTVYIQQPIAAAVPETAAFIERLEME-QAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMS 241

  Fly   219 GAT---NQDG 225
            ||:   ||.|
 Frog   242 GASDAGNQGG 251



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7650
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18036
Inparanoid 1 1.050 91 1.000 Inparanoid score I4962
OMA 1 1.010 - - QHG47061
OrthoDB 1 1.010 - - D1514526at2759
OrthoFinder 1 1.000 - - FOG0005767
OrthoInspector 1 1.000 - - oto103980
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4444
SonicParanoid 1 1.000 - - X4156
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.