DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and Smc2

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001102136.2 Gene:Smc2 / 362519 RGDID:1305227 Length:1191 Species:Rattus norvegicus


Alignment Length:203 Identity:45/203 - (22%)
Similarity:80/203 - (39%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSWGFLEHDSWITVELQ-----------HSLAANS----ESFSFRG-NVTIPS--LNSG----LA 60
            |..||..||. |||..|           :.:.||:    :.|...| ||..|.  :..|    :.
  Rat    91 SPLGFEAHDE-ITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVL 154

  Fly    61 NVEQPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEP 125
            |::.|::    |.:::: |.|...|..|.            |.:.|.....:|:|.::.      
  Rat   155 NMKPPEI----LSMIEE-AAGTRMYEYKK------------IAAQKTIEKKEAKLKEIK------ 196

  Fly   126 SGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAE-LAPVPDTAGFIQKVE-REREA 188
                   |:.::....||:..:|:.:..||.|    .::|..| |:.:.....|:...: :||.|
  Rat   197 -------TILEEEITPTIQKLKEERSSYLEYQ----KVMREIEHLSRLYIAYQFLLAEDTKERSA 250

  Fly   189 RERGEVRD 196
            .|..|::|
  Rat   251 GELKEMQD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
Smc2NP_001102136.2 Smc 1..1168 CDD:224117 45/203 (22%)
ABC_SMC2_euk 1..>172 CDD:213240 22/86 (26%)
L_lactis_ph-MCP 252..>465 CDD:115336 3/7 (43%)
SMC_hinge 522..639 CDD:214944
PCRF 693..>761 CDD:305100
DUF4200 740..841 CDD:290574
P-loop_NTPase <1074..1168 CDD:304359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.