Sequence 1: | NP_730662.2 | Gene: | EMC10 / 40396 | FlyBaseID: | FBgn0052441 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102136.2 | Gene: | Smc2 / 362519 | RGDID: | 1305227 | Length: | 1191 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 80/203 - (39%) | Gaps: | 59/203 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 SSWGFLEHDSWITVELQ-----------HSLAANS----ESFSFRG-NVTIPS--LNSG----LA 60
Fly 61 NVEQPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEP 125
Fly 126 SGYVTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAE-LAPVPDTAGFIQKVE-REREA 188
Fly 189 RERGEVRD 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EMC10 | NP_730662.2 | None | |||
Smc2 | NP_001102136.2 | Smc | 1..1168 | CDD:224117 | 45/203 (22%) |
ABC_SMC2_euk | 1..>172 | CDD:213240 | 22/86 (26%) | ||
L_lactis_ph-MCP | 252..>465 | CDD:115336 | 3/7 (43%) | ||
SMC_hinge | 522..639 | CDD:214944 | |||
PCRF | 693..>761 | CDD:305100 | |||
DUF4200 | 740..841 | CDD:290574 | |||
P-loop_NTPase | <1074..1168 | CDD:304359 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1196 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |