DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and smc3

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_999854.1 Gene:smc3 / 324475 ZFINID:ZDB-GENE-030131-3196 Length:1216 Species:Danio rerio


Alignment Length:160 Identity:34/160 - (21%)
Similarity:63/160 - (39%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TIPSLNSGLANVEQPDLS-TADL--DLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQ 112
            ::.||.:.|..:|....| .|:|  |||.:|:|.::               .:....|...|.||
Zfish   759 SLQSLEASLHAMESTRESLKAELGADLLSQLSLEDQ---------------RRVDDLNDEIRQLQ 808

  Fly   113 AQLNDVLWVSLEPSGYVTGI-TVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAEL------- 169
            .....:|...::..|.:|.: |...:.....::..::::|:|.||:..|.:....:||       
Zfish   809 QDNRQLLNERIKLEGIMTRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELDGINKRI 873

  Fly   170 ----APVPDTAGFIQKVEREREARERGEVR 195
                |...|....|.|.|.|.:..::...|
Zfish   874 KDTMARSEDLDTLIDKTEVEIKEHQKSMER 903

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
smc3NP_999854.1 Smc 1..1193 CDD:224117 34/160 (21%)
ABC_SMC3_euk 3..>158 CDD:213239
RILP-like <222..337 CDD:304877
BAR <388..>482 CDD:299863
SMC_hinge 530..642 CDD:214944
MIT_CorA-like <700..>836 CDD:294313 20/91 (22%)
P-loop_NTPase <1104..1198 CDD:304359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.