DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and Smc5

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006231245.1 Gene:Smc5 / 293967 RGDID:1307492 Length:1102 Species:Rattus norvegicus


Alignment Length:123 Identity:33/123 - (26%)
Similarity:53/123 - (43%) Gaps:32/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LKKLALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVSQDTA 139
            ||::....|.|.|| |..|||    :.|:||.:.::.|.                  :||:.|..
  Rat   609 LKQIYTAEEKYVLK-TSFYSN----KVISSNTSLKVAQF------------------LTVTVDLE 650

  Fly   140 PAT-IECTQEDVNKLLETQFSTDVLI----RHAELAPVPDTAGFIQKVE-REREARER 191
            ... :|...:::|:.||...|..|.:    ||.||   .|....::|.| .||:.::|
  Rat   651 QRRHLEEQLKEINRKLEAVDSGLVALRDTNRHLEL---KDNELRLKKKELLERKTKKR 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
Smc5XP_006231245.1 ABC_SMC5_euk 51..>196 CDD:213244
Smc 53..1055 CDD:224117 33/123 (27%)
ABC_SMC5_euk <975..1077 CDD:213244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.