DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and Emc10

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001004221.2 Gene:Emc10 / 292878 RGDID:1303214 Length:268 Species:Rattus norvegicus


Alignment Length:208 Identity:64/208 - (30%)
Similarity:109/208 - (52%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITVELQHSL-AANSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKLALGNEFYRLK---- 88
            :.:.|:||. ..:..:|..||:: :.:...|..:..|..||..:...|:.:|..|..||::    
  Rat    62 VALLLEHSFEIGDGANFQKRGSL-LWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRVRVPRR 125

  Fly    89 -ATVVYS--NGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVSQDTAPATI---ECTQ 147
             .|:..|  .|..:.|:   .||.|:::.|:|.|.:.::.:|.|.|::|.  ..|...   |...
  Rat   126 PGTLDGSEAGGHVSSFV---PACSLVESHLSDQLTLHVDVAGNVVGLSVV--VYPGGCRGSEVED 185

  Fly   148 EDVNKLLETQFSTDVLIRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKYWMYIVPVV 212
            ||:.     .|:|.|.:|....||.|:||.||:::|.| :|::....::.:.|||||||||:|||
  Rat   186 EDLE-----LFNTSVHLRPPGTAPGPETAAFIERLEME-QAQKAKNPQEQKSFFAKYWMYIIPVV 244

  Fly   213 LLVFISGATNQDG 225
            |.:.:|||.:..|
  Rat   245 LFLMMSGAPDAGG 257



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8280
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18036
Inparanoid 1 1.050 82 1.000 Inparanoid score I5106
OMA 1 1.010 - - QHG47061
OrthoDB 1 1.010 - - D1514526at2759
OrthoFinder 1 1.000 - - FOG0005767
OrthoInspector 1 1.000 - - oto97298
orthoMCL 1 0.900 - - OOG6_105206
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4156
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.940

Return to query results.
Submit another query.