DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and EMC10

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006723226.1 Gene:EMC10 / 284361 HGNCID:27609 Length:403 Species:Homo sapiens


Alignment Length:180 Identity:50/180 - (27%)
Similarity:93/180 - (51%) Gaps:17/180 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQHSLAA-NSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKLALGNEFYRLK-------A 89
            |:||... :|.:|..||:: :.:...|..::.|..||..:...|:.:|..|..||::       .
Human    56 LEHSFEIDDSANFRKRGSL-LWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGAL 119

  Fly    90 TVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVNKLL 154
            ..:.:.|..:.|:   .||.|:::.|:|.|.:.::.:|.|.|::|.  |.|.  .|...:|..:.
Human   120 DGLEAGGYVSSFV---PACSLVESHLSDQLTLHVDVAGNVVGVSVV--THPG--GCRGHEVEDVD 177

  Fly   155 ETQFSTDVLIRHAELAPVPDTAGFIQKVEREREARERGEVRDNRGFFAKY 204
            ...|:|.|.::....||.|:||.||:::|.| :|::....::.:.|||||
Human   178 LELFNTSVQLQPPTTAPGPETAAFIERLEME-QAQKAKNPQEQKSFFAKY 226



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8154
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18036
Inparanoid 1 1.050 86 1.000 Inparanoid score I5162
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47061
OrthoDB 1 1.010 - - D1514526at2759
OrthoFinder 1 1.000 - - FOG0005767
OrthoInspector 1 1.000 - - oto90179
orthoMCL 1 0.900 - - OOG6_105206
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4444
SonicParanoid 1 1.000 - - X4156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.970

Return to query results.
Submit another query.