DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and C44C10.5

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001359562.1 Gene:C44C10.5 / 183454 WormBaseID:WBGene00008086 Length:277 Species:Caenorhabditis elegans


Alignment Length:168 Identity:34/168 - (20%)
Similarity:63/168 - (37%) Gaps:48/168 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITVELQHSLA-ANSESFSFRGNVT-----IPSLNSGLANVE-QPDLSTADLDLLKKLALGNEFYR 86
            |.:||::.|. ..::......|||     ||:..:|..:.: :||.|:...:|.|:         
 Worm   108 IVIELENRLVQQRAQRRKIIANVTLQDLDIPAKEAGTFSYDVKPDYSSLPDELKKE--------- 163

  Fly    87 LKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVSQDTAPATIECTQEDVN 151
                   ||.|:...:........:||..|:  ||::..:.|                   .|::
 Worm   164 -------SNDAETVKMHLRTLEETIQATRNE--WVAVNGAEY-------------------PDMS 200

  Fly   152 KLLETQFSTDVLIRHAELAPVPDTAGFIQKVEREREAR 189
            .:|.....||..|..|:|.    |.....::|:.:.:|
 Worm   201 NILIRFHETDSFINIAKLR----TTELEAEIEQVKASR 234



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.