DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and smc-4

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_497935.1 Gene:smc-4 / 175603 WormBaseID:WBGene00004874 Length:1549 Species:Caenorhabditis elegans


Alignment Length:172 Identity:41/172 - (23%)
Similarity:73/172 - (42%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITV-ELQHSLAANSESFSFRGNVTIPSL----NSGLANVEQPDLSTADLDLLKKLA-LGNEFYRL 87
            :|| .|:.|:...|.||: .|..|:..|    .:.:|....|:...|:.||.:||. |.:|...|
 Worm   743 VTVCTLEGSMIHPSGSFT-GGGKTVKGLILTDKNKMAKQVTPEDKAAERDLAEKLGKLRDEADEL 806

  Fly    88 KATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGYVTGITVS-QDTAPATIECTQEDVN 151
            |......:|            :|::|:..     ..|.|..::.:|.| |..|||.     |.:.
 Worm   807 KGQEHEMDG------------QLIEARRK-----VAEMSNRLSIVTSSVQSAAPAI-----ETLK 849

  Fly   152 KLLETQFSTDVLIRHAELAPVPDTAGFIQKVEREREARERGE 193
            |.:..|......:: .:...:.|....::::|::|:  |.||
 Worm   850 KTIANQEKEAAKVK-VDAKTLEDKQKIVEELEKKRD--ELGE 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
smc-4NP_497935.1 ABC_SMC4_euk 90..>252 CDD:213241
SMC_N 91..1361 CDD:280601 41/172 (24%)
SMC_hinge 618..734 CDD:284001
MCP_signal 865..1037 CDD:304920 6/26 (23%)
ABC_SMC4_euk <1261..1362 CDD:213241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.