powered by:
Protein Alignment EMC10 and dpy-27
DIOPT Version :9
Sequence 1: | NP_730662.2 |
Gene: | EMC10 / 40396 |
FlyBaseID: | FBgn0052441 |
Length: | 227 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497771.1 |
Gene: | dpy-27 / 175492 |
WormBaseID: | WBGene00001086 |
Length: | 1469 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 13/63 - (20%) |
Similarity: | 26/63 - (41%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 VTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGFIQKVEREREARER 191
:.|.|.:....|..:|.....:.|:.|.:......:|.||:.|..|.:..:..|....:.::|
Worm 1324 IDGKTYNIMVDPIAVEIKNRPILKIFEEEIKRREKLRRAEIEPEIDLSNGLSNVVIAPKRKQR 1386
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1196 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.