DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and Smc3

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_031816.2 Gene:Smc3 / 13006 MGIID:1339795 Length:1217 Species:Mus musculus


Alignment Length:154 Identity:33/154 - (21%)
Similarity:65/154 - (42%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TIPSLNSGLANVE------QPDLSTADLDLLKKLALGNEFYRLKATVVYSNGAKAQFITSNKACR 109
            ::.||.:.|..:|      :.:|.|   |||.:|:|.:: .|:.|.              |...|
Mouse   759 SLQSLEASLHAMESTRESLKAELGT---DLLSQLSLEDQ-KRVDAL--------------NDEIR 805

  Fly   110 LLQAQLNDVLWVSLEPSGYVTGI-TVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVP 173
            .||.:...:|...::..|.:|.: |...:.....::..::::|:|.||:..|.:....:||..:.
Mouse   806 QLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAIN 870

  Fly   174 DTAGFIQKVEREREARERGEVRDN 197
                     :|.::...|.|..||
Mouse   871 ---------KRVKDTMARSEDLDN 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
Smc3NP_031816.2 Smc 1..1194 CDD:224117 33/154 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1059..1090
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.