DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and SMC2

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001036015.1 Gene:SMC2 / 10592 HGNCID:14011 Length:1197 Species:Homo sapiens


Alignment Length:201 Identity:40/201 - (19%)
Similarity:75/201 - (37%) Gaps:50/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VELQHSLAANSESFSF---------------RGNVTIPSLNSGLANVEQPDL-STADLDLLKKLA 79
            ::||..|:.|.:....               .|.: :.||...||..::.:. |.:..||.||..
Human   261 IKLQEELSENDKKIKALNHEIEELEKRKDKETGGI-LRSLEDALAEAQRVNTKSQSAFDLKKKNL 324

  Fly    80 LGNEFYR--LKATVV---------------YSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSG 127
            ...|..|  |:..:|               .::|..|....|||....|.|.......||     
Human   325 ACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNKDAEALAAAQQHFNAVS----- 384

  Fly   128 YVTGITVSQDTAPATIE----CTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGFIQKVE----R 184
              .|::.::|.|.||:.    ..:.|::|.........:.::||: ..:.:....::|::    :
Human   385 --AGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ-QELKNKQAEVKKMDSGYRK 446

  Fly   185 EREARE 190
            ::||.|
Human   447 DQEALE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
SMC2NP_001036015.1 Smc 1..1168 CDD:224117 40/201 (20%)
ABC_SMC2_euk 1..>172 CDD:213240
Uds1 <193..287 CDD:292096 4/25 (16%)
L_lactis_ph-MCP 252..>465 CDD:115336 40/201 (20%)
SMC_hinge 522..639 CDD:214944
DUF342 <636..777 CDD:302792
DUF4200 740..841 CDD:290574
P-loop_NTPase <1074..1168 CDD:304359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.