DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC10 and SMC4

DIOPT Version :9

Sequence 1:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001002800.1 Gene:SMC4 / 10051 HGNCID:14013 Length:1288 Species:Homo sapiens


Alignment Length:164 Identity:37/164 - (22%)
Similarity:66/164 - (40%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LANVEQPDLSTADLDLLKKLALGNE------FYRLKATVVYSNGAKAQFITSNKACR----LLQA 113
            :..::.|:.:....||:|   :.:|      ::.|:.|:|..|..:|..:...|..|    .||.
Human   681 MTEIQTPENTPRLFDLVK---VKDEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQG 742

  Fly   114 QLNDVLWVSLEPSGYVTG----ITVSQDTAPATIECTQEDVNKLLETQFSTD------------- 161
            |:       :|.||.:||    :...:..:...||.::|:||| :|:|...|             
Human   743 QI-------IEQSGTMTGGGSKVMKGRMGSSLVIEISEEEVNK-MESQLQNDSKKAMQIQEQKVQ 799

  Fly   162 -----VLIRHAELAPVPDTAGFIQKVEREREARE 190
                 |.:||:|.........|...::|..|..|
Human   800 LEERVVKLRHSEREMRNTLEKFTASIQRLIEQEE 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC10NP_730662.2 None
SMC4NP_001002800.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
ABC_SMC4_euk 82..>241 CDD:213241
SMC_N 83..1274 CDD:280601 37/164 (23%)
DUF4349 <327..427 CDD:305044
SMC_hinge 613..727 CDD:214944 10/48 (21%)
ABC_SMC4_euk <1181..1275 CDD:213241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.