DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRIF and gadd45gip1

DIOPT Version :9

Sequence 1:NP_649333.1 Gene:CRIF / 40395 FlyBaseID:FBgn0037102 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001345133.4 Gene:gadd45gip1 / 402803 ZFINID:ZDB-GENE-091204-282 Length:240 Species:Danio rerio


Alignment Length:235 Identity:73/235 - (31%)
Similarity:114/235 - (48%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVVTRLPALRSCAQYS-SAAKAELPASLVGDVDVEPTYPQTVDRSGLQPQHKNVLLNKLPY---- 66
            ::...|.:.|:.:.:| :...:.|||:::...:..|           :|...|:   |.||    
Zfish    19 NMAASLLSRRTASSFSFTKLNSLLPAAVIQIANYNP-----------RPLRLNL---KDPYIPDK 69

  Fly    67 --QEPHSWIHLTEKYQRQAFGRYGAQSNVNPKICFDSHGEKDSRQVMQLETLL-----------K 118
              :....| ..|||::|:.|||||..|.|||...:.|        ..:||.|:           :
Zfish    70 ESERTPEW-QKTEKFERRLFGRYGRASGVNPVKLWPS--------AARLEELMAEEREWHPPVEQ 125

  Fly   119 MLEKNRAQKAEELARINAREEDIAKKMEKLTQWKADLHAKIAKREADAAA--AIQRKERLVEEVR 181
            ||:....::.|:..|...||:.||:.|.|:.:..||.  |..||||...|  ..|::.||:...|
Zfish   126 MLQNIAERQMEKEKRRIEREKTIAESMAKMPKLIADW--KKQKREAKQKANEEKQKQVRLLAMAR 188

  Fly   182 RHFGFKVDTRDERFKEMLEQKEKEDKKKQKEAKRKAKEEK 221
            ..|||.||.|..:||||:.:.|||:||::|..||:.|||:
Zfish   189 ERFGFAVDPRSVKFKEMVAEIEKEEKKQRKLLKRQKKEEE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRIFNP_649333.1 CR6_interact 29..231 CDD:287157 70/212 (33%)
gadd45gip1XP_001345133.4 CR6_interact 20..238 CDD:287157 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592416
Domainoid 1 1.000 86 1.000 Domainoid score I8087
eggNOG 1 0.900 - - E1_KOG4848
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431395at2759
OrthoFinder 1 1.000 - - FOG0007222
OrthoInspector 1 1.000 - - oto40232
orthoMCL 1 0.900 - - OOG6_109424
Panther 1 1.100 - - LDO PTHR31761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5556
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.