DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRIF and Gadd45gip1

DIOPT Version :9

Sequence 1:NP_649333.1 Gene:CRIF / 40395 FlyBaseID:FBgn0037102 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001093974.1 Gene:Gadd45gip1 / 288916 RGDID:1309249 Length:228 Species:Rattus norvegicus


Alignment Length:185 Identity:57/185 - (30%)
Similarity:92/185 - (49%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PQHKNVLLNKLPYQEPHSWIHLTEKYQRQAFGRYGAQSNVNPKICFDSHGEKDSRQVMQLE---- 114
            |..:|::..:        | .||.:|..:.|||:||.|.|.|...:.|     |.|:.:||    
  Rat    40 PDRENLMTPR--------W-QLTPRYAAKQFGRHGAISGVPPASLWPS-----SEQLCELEAEER 90

  Fly   115 ----TLLKMLEKNRAQKAEELARINAREEDIAKKMEKLTQ----WKADLHAKIAKREADAAAAIQ 171
                :|..|.|..|.|:....||..|||:.||:.|.|:.|    |:.....:..|.:||.    :
  Rat    91 EWYPSLATMQESLRVQQQAAEARRQAREQHIAECMAKMPQMIENWRKQKRERWEKIQADK----E 151

  Fly   172 RKERLVEEVRRHFGFKVDTRDERFKEMLEQKEKEDKKKQKEAKRKAKEEKMMAKL 226
            |:.||..|.:...|:.||.|..||:|:|:..:|:.:|:.||.:::.|:|..:|.:
  Rat   152 RRARLQAEAQEQLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRIFNP_649333.1 CR6_interact 29..231 CDD:287157 57/185 (31%)
Gadd45gip1NP_001093974.1 CR6_interact 1..211 CDD:287157 57/185 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..44 1/3 (33%)
Nuclear localization signal. /evidence=ECO:0000255 184..200 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..228 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350699
Domainoid 1 1.000 79 1.000 Domainoid score I8516
eggNOG 1 0.900 - - E1_KOG4848
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431395at2759
OrthoFinder 1 1.000 - - FOG0007222
OrthoInspector 1 1.000 - - oto97380
orthoMCL 1 0.900 - - OOG6_109424
Panther 1 1.100 - - LDO PTHR31761
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.